SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014948 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014948
Domain Number 1 Region: 16-206
Classification Level Classification E-value
Superfamily Nudix 1.09e-30
Family MutT-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014948   Gene: ENSNLEG00000012298   Transcript: ENSNLET00000015694
Sequence length 232
Comment pep:known_by_projection supercontig:Nleu1.0:GL397271.1:13527372:13556284:1 gene:ENSNLEG00000012298 transcript:ENSNLET00000015694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRRNKEKTTTLLILRTWE
SVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPVGGYCIEFPAGLIDDGETPEA
AALRELEEETGYKGDVAECSPAVCLDPGLSNCTVHIVTVTINGDDAENARPKPKPGILEF
VEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
Download sequence
Identical sequences ENSNLEP00000014948 ENSNLEP00000014948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]