SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014960 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014960
Domain Number 1 Region: 468-774
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-68
Family Protein kinases, catalytic subunit 0.000000000367
Further Details:      
 
Domain Number 2 Region: 253-356
Classification Level Classification E-value
Superfamily Immunoglobulin 4.49e-23
Family I set domains 0.00000271
Further Details:      
 
Domain Number 3 Region: 162-247
Classification Level Classification E-value
Superfamily Immunoglobulin 7.88e-20
Family I set domains 0.0000096
Further Details:      
 
Domain Number 4 Region: 40-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000264
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014960   Gene: ENSNLEG00000012322   Transcript: ENSNLET00000015707
Sequence length 817
Comment pep:known_by_projection supercontig:Nleu1.0:GL397325.1:8815307:8871481:-1 gene:ENSNLEG00000012322 transcript:ENSNLET00000015707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSG
TPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHT
YQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGP
DNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEAL
EERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIP
LRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGK
PLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNVSA
DGAALCWLTPCGSPPICRWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNC
TNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRS
STCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
Download sequence
Identical sequences ENSNLEP00000014960 ENSNLEP00000014960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]