SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000014971 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000014971
Domain Number 1 Region: 10-78,123-251,284-399,489-591
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.44e-31
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 
Domain Number 2 Region: 420-454
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000416
Family Ovomucoid domain III-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000014971   Gene: ENSNLEG00000012325   Transcript: ENSNLET00000015718
Sequence length 643
Comment pep:known_by_projection supercontig:Nleu1.0:GL397317.1:9230811:9556094:1 gene:ENSNLEG00000012325 transcript:ENSNLET00000015718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGARGHRPRLI
GCGGIVMALGALLSALPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRN
RTATNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRRKDSSLYIGILFTMLVFGPACG
FILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLFFSSLLMFGFPQSL
PPHSDPAMESEQAMLPEREYERPKPSNGVLRHPLEPDSSASCFQQLRVIPKVTKHLLSNP
VFTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL
VKKLSLSALGAIRMAMLVNLVSTACYVSFLFLGCDTGPVAGVTVPYGNNTAPGSALDPYS
PCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTGCACLTTVPAENATVVPGKCPS
PGCQEAFLTFLCVMCICSLIGAMAQTPSVIILIRTVSPELKSYALGVLFLLLRLLGFIPP
PLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRYLYVSIAIALKSFAFILYTTTWQCLR
KNYKRYIKNHEGGLSTSTEYQDIETEKTCPESHSPSEDSFVRS
Download sequence
Identical sequences A0A2K6RJ76
ENSNLEP00000014971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]