SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015058 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015058
Domain Number 1 Region: 51-499
Classification Level Classification E-value
Superfamily Sema domain 6.8e-145
Family Sema domain 0.0000000138
Further Details:      
 
Domain Number 2 Region: 495-546
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000384
Family Plexin repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015058
Domain Number - Region: 558-637
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0531
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015058   Gene: ENSNLEG00000012367   Transcript: ENSNLET00000015812
Sequence length 758
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:6932848:6959188:1 gene:ENSNLEG00000012367 transcript:ENSNLET00000015812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPALGLDPWSLLGLFLFQLLQLLLPTTTAGGGGQGPMPRVRYYAGDERRALSFFHQKG
LQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKSMIPWPASDRKKSECAFKKKSN
ETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDP
AHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPST
QVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCSQPGQLP
FNVIRHAVLLPADSPTAPHIYAVFTSQWQVGRTRSSAICAFSLLDIERVFKGKYKELNKE
TSRWTTYRGPETNPRPGSCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSDVEYTRLAV
ETAQGLDGHSHLVMYLGTTTGSLHKPVVSGDSSAHLVEEIQLPDPEPVRNLQLAPTQGAV
FVGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWDPASRTCCLLSAPNLNSWKQDMERG
NPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPCPHLSALASYYWSHGPAAVPEA
SSTVYNGSLLLIVQDGVGGLYQCWATENGFSYPVISYWVDSQDQTLALDPELAGIPREHV
KVPLTRVSGGAALAAQQSYWPHFVTVTVLFALVLSGALIILLASPLRALRARGKVQGCET
LRPGEKAPLSREQHLQSPKECRTSASDVDADNNCLGTD
Download sequence
Identical sequences ENSNLEP00000015058 ENSNLEP00000015058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]