SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015067 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015067
Domain Number 1 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000707
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015067   Gene: ENSNLEG00000012399   Transcript: ENSNLET00000015822
Sequence length 256
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:24737537:24799425:1 gene:ENSNLEG00000012399 transcript:ENSNLET00000015822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQV
HETNPLEMLRLDNTLEEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKADKPKVD
EEGDENEDDKDYHRSDPQIAICLDCLRNNGQSGDNVVKGLMKKFIRCSTRVTVGTIKKFL
SLKLKLPSSYELDVLCNGEIMGKDHTMEFIYMTRWRLRGENFRCLNCSASQVCSQDGPLY
QSYPMVLQYRPRIDFG
Download sequence
Identical sequences A0A0D9R2Y4 A0A2I2YFH5 A0A2I3HMN9 A0A2K5IP80 A0A2K5P796 A0A2K6NDI7 H2NAZ9 Q86SE9
ENSGGOP00000023105 ENSP00000337500 ENSP00000445704 ENSP00000337500 9600.ENSPPYP00000002869 9606.ENSP00000337500 ENSPPYP00000002869 ENSGGOP00000023105 ENSNLEP00000015067 NP_001243478.1.87134 NP_001243478.1.92137 NP_001244030.1.87134 NP_001244030.1.92137 NP_115749.2.87134 NP_115749.2.92137 XP_002821014.1.23681 XP_003255263.1.23891 XP_004049832.1.27298 XP_004087624.1.23891 XP_007961715.1.81039 XP_007961716.1.81039 XP_010361820.1.97406 XP_010361821.1.97406 XP_011538573.1.92137 XP_011803240.1.43180 XP_011803241.1.43180 XP_011918473.1.92194 XP_011918474.1.92194 XP_011918475.1.92194 XP_011918476.1.92194 XP_016872265.1.92137 XP_018890897.1.27298 XP_018890898.1.27298 gi|33300663|ref|NP_115749.2| ENSPPYP00000002869 HT6302 ENSNLEP00000015067 ENSP00000337500 ENSP00000445704 ENSP00000479492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]