SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015073 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015073
Domain Number 1 Region: 135-231
Classification Level Classification E-value
Superfamily Immunoglobulin 3.75e-25
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 509-701
Classification Level Classification E-value
Superfamily Fibronectin type III 9.38e-25
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 3 Region: 228-324
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 28-144
Classification Level Classification E-value
Superfamily Immunoglobulin 4.27e-16
Family I set domains 0.032
Further Details:      
 
Domain Number 5 Region: 410-507
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000198
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 327-424
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000528
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015073   Gene: ENSNLEG00000012411   Transcript: ENSNLET00000015828
Sequence length 1349
Comment pep:known_by_projection supercontig:Nleu1.0:GL397521.1:17253:53864:-1 gene:ENSNLEG00000012411 transcript:ENSNLET00000015828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWYVATFIASVIGTRGLAAQGAHGLREEPEFVTARAGESVVLRCDVIHPVTGQPPPYVV
EWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLMLDQ
QYDTFHNGSWVHLTVNAPPTFTETPPQYIEAKEGSSITMTCTAFGNPKPIVTWLKEGTLL
GASGKYQVSDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITV
NISQDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDGTLIIFRVKPEDSGK
YTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATMVKWN
KDGRPLQVEKNLGWTLMEDGSIRIEEATEEALGTYTCVPYNTLGTMGQSAPARLVLKDPP
YFTVLPGWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHSVLPTGSLQFRALSK
EDHGEWECVATNVVTSITASTHLTVIGTSPHAPGSVRVQVSMTTANVSWEPGYDGGYEQT
FSVWMKRAQFGPHDWLSLPVPPGPSWLLVDTLEPETAYQFSVLAQNKLGTSAFSEVVTVN
TLAFPITTPEPLVLVTPPRCLIANRTQQGVLLSWLPPANHSFPIDRYIMEFRVAERWELL
DDGIPGTDLEFLAKGLSQDTWYEFRVLAVMQDLISEPSNIAGVSSTGILVKKDLIEVLFA
RPRLRSSSSRTCRVGEVLVWSAISALYIRHQRALKKHRTHNPPLSITHCRKSLESPLSSG
KVSPESIRTLRAPSESSDDQGQPAAKRMLSPTREKELSLYKKTKRAISSKKYSVAKAEAE
AEATTPIELISRGPDGRFVMDPAEMEPSLKSRRIEGFPFAEETDMYPEFRQSDEENEDPL
VPTSVAALKSQLTPLSSSQESYLPPPAYSPRFQPRGLEGPGGLEGRLQATGQARPPAPRP
FHHGQSYGYLSSSSPGEVEPPPFYVPEVGSPLSSVMSSPPLPTEGPFGHPPIPEENGENA
SNSTLPLTQTPTGGRSPEPWGRPEFPFGGLETPAMMFPHQLPPCDVPESLQPKAGLPRGL
PPTSLQVPAAYPGILSLEAPKGWAGKSPGRGPAPAPPAAKWQDRPMQPLVSQGQLRHTSQ
GMGIPVLPYPEPAEPGAHGGPSTFGLDTRWYEPQPRPRPSPRQARRAEPSLHQVVLQPSR
LSPLTQSPLSSRTGSPELAARARPRPGLLQQAEMSEITLQPPAAVSFSRRSTPSTGSPSQ
SSRSGSPSYRPAMGFTTLATGYPSPPPGPAPAGPGDSLDVFGQTPSPRRMGEELLRPEPP
PPTLPTSGKLQRDRQAPATSPPGRALSKL
Download sequence
Identical sequences ENSNLEP00000015073 ENSNLEP00000015073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]