SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015087 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015087
Domain Number 1 Region: 60-188
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000691
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015087   Gene: ENSNLEG00000012413   Transcript: ENSNLET00000015842
Sequence length 672
Comment pep:known_by_projection supercontig:Nleu1.0:GL397283.1:7871691:7891404:1 gene:ENSNLEG00000012413 transcript:ENSNLET00000015842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQPSLTWMLMVMVASWFITTAATNTSEARTKYNCPARWSWRTPQRGGDTEQGPDEAFTS
QGRWCSECHSNATCTEDEAITTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTP
GSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGNYLCVCPAGYRGDGWH
CECSPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLRGWYRFVG
QGGARLAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKAC
AGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSDNGRWHCQCKQDFNITDIS
LLEHRLECGANDMKSLGKCQLKSLGFDKVFMYSDSRCSGFHDRDNRDWVSVVTPARDGPC
GTVLTRNETHATYSNTLYLADEIIIRDRNIKINFACSYPLDMKVSLKTSLQPMVSALNIR
VGGTGMFTVRMALFQNPSYTQPYQGSSVTLSTEAFLYVGTMLDGGDLSRFALLMTNCYAT
PSGNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVY
LCDTMNEKCKPTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAAFSSLGLLKVWLP
LLLSATLTLTFQ
Download sequence
Identical sequences ENSNLEP00000015087 ENSNLEP00000015087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]