SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015130 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015130
Domain Number 1 Region: 526-750
Classification Level Classification E-value
Superfamily GFP-like 1.57e-85
Family Domain G2 of nidogen-1 0.000000528
Further Details:      
 
Domain Number 2 Region: 1106-1362
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-42
Family YWTD domain 0.0000000923
Further Details:      
 
Domain Number 3 Region: 900-1007
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.44e-22
Family Thyroglobulin type-1 domain 0.00044
Further Details:      
 
Domain Number 4 Region: 1013-1083
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.02e-19
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 5 Region: 482-523,761-858
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.65e-18
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 850-908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000629
Family EGF-like domain of nidogen-1 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015130   Gene: ENSNLEG00000012432   Transcript: ENSNLET00000015886
Sequence length 1374
Comment pep:known_by_projection supercontig:Nleu1.0:GL397312.1:2664866:2728162:-1 gene:ENSNLEG00000012432 transcript:ENSNLET00000015886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGDRVAGRPALSLLPVLLLLPLLMSRAAALHSDELFPHGESGGDQLLQKGDDEASRGELP
TPLHFYKARFSNLYVGTNGIISTQDFPRETQYVDYDFPTDFPAIAPFLADIDTSHGRGRV
LYREDTSPAVLGLAARYVRAGFPRSARFTPTHAFLATWEQVGAYEEVKRGALPSGELNTF
QAVLASDRSDSYALFLYPANGLQFLGTRPKESYNVQLQLPARVGFCRGEADDLKSEGPYF
SLTSTEQSVKNLYQLSNLGIPGVWAFHIGSTSPLDNVRPAAVGGDLSAARSYVPLGRSFS
HATALESDYNEDNLDYYDMNEEEAEYLPGEPEEALNGHSSIDVSFQSKVDTKPLEESSTL
DPHTKEGTSLGEVEGPDLKGQVAPWDERGTRSPAPPEVDRDSLAPSWETPPPYPENGSIQ
PYPDGGPVPSEMDVPSAHPEKEIVLRNYPASGHTTPISQGTYEVGLEDNIGSNTEVFTYN
AANKETCEHNHRQCSRHAFCTDYATGFCCHCQSKFYGNGKHCLPEGAPHRVNGKVSGHLH
VGHTPVHFTDVDLHAYIVGNDGRAYTAISHIPQPAAQALLPLTPIGGLFGWLFALEKPGS
ENGFSLAGAAFTHDMEVTFYPGEERVHITQTAEGLDPENYLSIKTNIQGQVPYVPANFTA
HISPYKELYHYSDSTVTSTSSRDYSLTFGAVNQTWSYRIHQNITYQVCRHAPRRPSFPTT
QQLNVDRVFALYNDEERVLRFAVTNQIGPVKEDSDPTPVNPCYDGSHMCDTTARCHPGTG
VDYTCECASGYQGDGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRHT
CVLITPPANPCEDGSHTCAPAGQARCVHHGGSMFSCACLPGYAGDGHQCTDVDECSENRC
HPAATCYNTPGSFSCRCQPGYYGDGFQCIPDSTSSLTPCEQQQRHAQAQYAYPGAQFHIP
QCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHCGPPPEPTQRPPTICER
WRENLLEHYGGTPRDDQYVPQCDDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTT
PACIPTVAPPMVRPTPRPDVTPPSVGTFLLYAQGQQIGYLPLNGTRLQKDAAKTLLSLHG
SIIVGIDYDCRERMVYWTDVAGRTISRASLELGAEPEMIVNSGLISPEGLAIDHIRRTMY
WTDSVLDKIESALLDGSERKVLFYTELVNPRAIAVDPIRGNLYWTDWNREAPKIETSSLD
GENRRILINTDIGLPNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFSI
VSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK
Download sequence
Identical sequences ENSNLEP00000015130 ENSNLEP00000015130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]