SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015155 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015155
Domain Number 1 Region: 388-604
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-43
Family YWTD domain 0.00000000142
Further Details:      
 
Domain Number 2 Region: 103-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 3 Region: 196-233
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 4 Region: 142-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 5 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 6 Region: 66-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0001
Further Details:      
 
Domain Number 7 Region: 302-383
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000487
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 656-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000488
Family EGF-type module 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015155   Gene: ENSNLEG00000012467   Transcript: ENSNLET00000015912
Sequence length 707
Comment pep:known_by_projection supercontig:Nleu1.0:GL397381.1:2414342:2450296:1 gene:ENSNLEG00000012467 transcript:ENSNLET00000015912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSWGWKLRWTVALFLAAAGAAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQ
ETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCENGSDEQGCPPRTCSQDEFRCHDGK
CIYRQFVCDSDQDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEW
PQRCGGLDVFQGDSGPCSAFEFHCRSGECIHSSWRCDGGPDCKDKSDEENCGMGGAGGGG
GAFYHLSLGSPRCGLCSDLGAEVDFEQHAKKIFPFHMESHSSETPSLLKIKLARHVCIPW
PCAGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVN
LEGGYKCQCEEGFQLDPHSKACKAVGSIAYLIFTNRHEVRKMTLDRSEYTSLIPNLRNVV
ALDTEVASNRIYWSDLSQRMIYSTQLDRAHGVSSYDTVISRDLQAPDGLAVDWIHSNIYW
TDSVLGAVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIRKGGLNGV
DIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHCISSIDVNGGNRKTVLEDEKRLAHPFS
LAIFEVRLGRVTEVLADCLLRATYVRDARNSAPPPTLKPPCGNSGMFWKFLESSGVNWCE
KTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTGA
Download sequence
Identical sequences ENSNLEP00000015155 ENSNLEP00000015155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]