SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015174 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015174
Domain Number 1 Region: 1203-1295
Classification Level Classification E-value
Superfamily Immunoglobulin 2.35e-24
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 931-1028
Classification Level Classification E-value
Superfamily Immunoglobulin 7.03e-23
Family I set domains 0.0084
Further Details:      
 
Domain Number 3 Region: 125-226
Classification Level Classification E-value
Superfamily Immunoglobulin 4.77e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 580-675
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-21
Family I set domains 0.0082
Further Details:      
 
Domain Number 5 Region: 843-935
Classification Level Classification E-value
Superfamily Immunoglobulin 4.63e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 1125-1210
Classification Level Classification E-value
Superfamily Immunoglobulin 2.91e-20
Family I set domains 0.027
Further Details:      
 
Domain Number 7 Region: 32-131
Classification Level Classification E-value
Superfamily Immunoglobulin 4.77e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 8 Region: 1015-1113
Classification Level Classification E-value
Superfamily Immunoglobulin 6.43e-20
Family I set domains 0.018
Further Details:      
 
Domain Number 9 Region: 399-498
Classification Level Classification E-value
Superfamily Immunoglobulin 8.98e-20
Family I set domains 0.026
Further Details:      
 
Domain Number 10 Region: 220-313
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-19
Family I set domains 0.017
Further Details:      
 
Domain Number 11 Region: 486-585
Classification Level Classification E-value
Superfamily Immunoglobulin 2.65e-17
Family I set domains 0.042
Further Details:      
 
Domain Number 12 Region: 770-845
Classification Level Classification E-value
Superfamily Immunoglobulin 7.04e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 13 Region: 677-755
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000488
Family I set domains 0.0075
Further Details:      
 
Domain Number 14 Region: 307-407
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000034
Family I set domains 0.036
Further Details:      
 
Domain Number 15 Region: 1-39
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000242
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015174   Gene: ENSNLEG00000012484   Transcript: ENSNLET00000015931
Sequence length 1338
Comment pep:novel supercontig:Nleu1.0:GL397403.1:43359:78007:1 gene:ENSNLEG00000012484 transcript:ENSNLET00000015931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEIQEAQVSDKGLYSCKVSNVAGEAVRTFTLTVQVPPTFENPKTETVSQVAGSPLVLTCD
VSGVPAPTVTWLKDRMPVESSVVHGVVSQGGRLQLSRLQLAQAGTYTCVAENTQAEARKD
FVVAVLVAPRIRSSGAAQEHHVLEGQEVRLDCEADGQPPPDVAWLKDGSPLGQDMGPHLR
FYLDGGSLVLKGLRASDAGAYTCVAHSPAGEDARLHTVNVLVPPTIEQGADGSGTLVSRP
GELVTMVCPVRGSPPIHVSWLKDGLPLPLSQRTLLHGSGRTLRISQVQLADAGIFTCVAA
SPAGVADRNFTLQCPLSWSRWSSRMTWWWFVAPQWNSRARPGVFPCLSCRMKDGEPLLSQ
SLEQGPSLQLEAVGAGDSGTYSCVAVSEAGEARRHFQLTVMEPPHIEDSGQPTELSLTPG
APMELLCDAQGTPQPNITWHKDGQALTRLENSIRATRVLRVESVQVRDAGLYTCLAESPA
GAIEKSFRVRVQAPPNIVGPRGPRFVVGLAPGQLVLECSVEAEPAPKITWHRDGIVLQED
AHTQFPQRGRFLQLQALSTADSGDYSCTARNAAGSTSVAFRVEIHTVPSIRSGPPAVNVS
VNQTALLPCQADGVPAPLVSWRKDGVPLDPRSPRFEILPEGSLRIQPVLAQDAGRYLCLA
SNSAGSDRQGRDLWVFASLPCEASGSPKPLVVWWKDGQKLDFRLQQGTYRLLPSNALLLM
APGPQDSAQFECVVSNEVGEARRLYQVTVHVPPTIADDQTDFTVTMMAPVLTCHSTGIPA
PTVSWSKAGAQLGARGSGYRVSPSGALEIGQALPIHAGRYTCSARNSAGVAHKHVFLTVQ
ASPVVKLLPSVVRAVAEQEVLLPCEASGIPRPTITWQKEGLNVPTGVSTQVLPGGQLRIA
HASPEDAGNYLCIAKNSAGSAMGKTRLVVQVPPVIENGLPDLSTTEGSHAFLPCKARGSP
EPNITWDKDGQPVPGTEGKFTIQPSGELLVKNLEGRDAGTYTCTAENAMGRAHRRVHLTI
LALPVFTTLPGDRSLRLGDRLWLRCAARGSPTPRIGWTVNDQPVTEGVSEQDGGSTLQRA
AVSREDSGTYVCWAENRVGRTQAVSFVHVKEAPVLQGEAFSYLVEPVGGSMQLDCVVHGD
PVPDIRWIKDGLPLRGSHLRHHLQNGSLTIRRTERDDAGQYQCLAENEMGVAKKVVILVL
QSAPVFQVEPQDMTVRSGDDVALRCQATGEPTPTIEWLREGQPLQASRRLRTLPDGSLWL
ENVETGDAGAYDCVAHNLLGSATARAFLVVRGMGHPCLDLRGQRQDLLTMGIVWCLWGTC
PLPCHLPTSSLCFVTSPE
Download sequence
Identical sequences ENSNLEP00000015174 ENSNLEP00000015174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]