SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015212 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015212
Domain Number 1 Region: 476-587
Classification Level Classification E-value
Superfamily Cadherin-like 2e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 582-697
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-19
Family Cadherin 0.0023
Further Details:      
 
Domain Number 3 Region: 690-803
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-17
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 118-169,412-474
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000786
Family Cadherin 0.0033
Further Details:      
 
Domain Number 5 Region: 923-1046
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000642
Family Cadherin 0.0019
Further Details:      
 
Domain Number 6 Region: 23-124
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000914
Family Cadherin 0.0037
Further Details:      
 
Domain Number 7 Region: 798-905
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000343
Family Cadherin 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015212   Gene: ENSNLEG00000012521   Transcript: ENSNLET00000015969
Sequence length 1312
Comment pep:known_by_projection supercontig:Nleu1.0:GL397498.1:257911:286358:1 gene:ENSNLEG00000012521 transcript:ENSNLET00000015969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLWLSCFLLPALVVSVAANVAPKFLANMTSVILPEDLPVGAQAFWLVAEDQDNDPLTY
GMSGSNAYFFTVTPKTGEVKLASALDYETLYTFKVTISVSDPYVQVQKEMLVIVEDRNDN
APVFQNTAFSTSINETLPVGSVVFSVLAVDKDMGSAGMVVYSIEKVSPSPGPQTVLWPPA
PLPGNLAFPTCLKTVPAADQTLLPARPLPGLVQVPQTIRDSRPLLSVGTWLQDPGHQNPW
LLKSLTCNGVVFACNLDTSSCVLSITSRLPPIPMQCKYSVNIACYVILFXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXCCCGGWGWGAPAQAWDPQCLGSCLLRSPHLQGLVTSP
ASCTLSRGLLRAPFHGTSSGGASRDRSLGDRSLLDSPPLQGSNGTFLLSLGGPDAEAFSV
SPERAAGSASVQVLVRVSALVDYERQTVMAVEVVATDSVSQNFSIAMVTIHLRDINDHRP
TFPQSLYVLTVPEHSATGSVVTDSIHATDPDTGAWGQITYSLLPGNGADLFQVDPVSGMV
TVRNGELLDRESQAVYYLTLQATDGGNLSSSTTLQIHLLDINDNAPVVSGSYNIFVQEEE
GNVSVTIQAHDNDEPGTNNSRLLFSLLPGPYSHNFSLDPDTGLLRNLGPLDREAIDPALG
GRIVLTMLVSDCGEPVLSTKVNVTITVEDINDNLPIFNQSSYNFTVKEEDPGVLVGVLKA
WDADQTEANNRISFSLSGSGANYFMIRGLVLGAGWAEGYLRLPPDVSLDYETQPVFHLTV
SAENPDPQGGETVVDVRVNVEDVNDNPPTLDVASLRGIRVAENGSQHGQVAVVVASDVDT
SSQLEIQLVNILCTKAGVDVGSLCWGWFSVAANGSVYINQSKAIDYEACDLVTLVVRACD
LATDPGFEAYSNNGSLLITIEDVNDNAPYFLPEDKTFVIIPELVLPNREVASVRARDDDS
GNNGVILFSILRVDFISKDGATIPSQGVFWIFTSSEADVFTGSIQPVTSLDSTLQGTYQV
TVQATDRPSVGPFLEASTTLNLFTVDQSYRSRLQFSTPKEEVGANRQAINAALTQATRTT
VYIVDIQDIDSAARARPHSYLDAYFVFPNGSALTLDELSVMIRNDQDSLTQLLQLGLVVL
GSQESQESDLPNQLINVIIGLGVALLLVLVIMTTAFVCVRKSYNRKLRAMKAAKEARKTA
AGVMPSAPAIPGTNMYNTERANPMLNLPNKDLGLEYLSPSSDLDSVSRDHGDDDNDDGGG
DDVGVKEHRPPHTPPEPDPEPLSVVLLEQQAGASGQLEGPSYINAGLDTTDL
Download sequence
Identical sequences ENSNLEP00000015212 ENSNLEP00000015212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]