SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015252 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015252
Domain Number 1 Region: 19-379
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.73e-80
Family Ankyrin repeat 0.0000107
Further Details:      
 
Domain Number 2 Region: 405-499
Classification Level Classification E-value
Superfamily DEATH domain 1.35e-18
Family DEATH domain, DD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015252   Gene: ENSNLEG00000012524   Transcript: ENSNLET00000016024
Sequence length 514
Comment pep:known_by_projection supercontig:Nleu1.0:GL397307.1:8559637:8597495:1 gene:ENSNLEG00000012524 transcript:ENSNLET00000016024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEELAWATDGLLPLERQLHEAARQNNVSRMQELIGRRVNTRARNHVGRVALHWAAGAGH
EQAVRLLLEHEAAVDEEDAVGALTEACLCFGMNALLLSAWFGHLRILQILVNSGAKIHCE
SKDGLTLLHCAAQKGHVPVLAFIMEDLEDVALDHVDKLGRTAFHRAAEHGQLDALDFLVG
SGCDHSVKDKEGNTALHLAAGRGHMAVLQRLVDIGLDLEEQNAEGLTALHAAAGGSHPDC
VQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVFRVLIHAGGCTNVVDHQGASPLHLAVR
HNFPALVRLLINSDSDLNTMDNRQQTPLHLAAEHAWQDIAEMLLIAGVDLNLRDKQGKTA
LAVAARSNHVSLVDMIIKADRFYRWEKDHPSDLSGKSLSFKQDHRQETQQLRSVLWRLAS
RYLQPREWKKLAYSWEFTEAHVYAIEQQWTGTRSYQEHGHRMLLIWLHGVATADENPSKA
LFEGLVAIGRRDLAENIRKKANAAPSAPRRCTAM
Download sequence
Identical sequences ENSNLEP00000015252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]