SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015259 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015259
Domain Number 1 Region: 746-826
Classification Level Classification E-value
Superfamily DEATH domain 1e-19
Family DEATH domain, DD 0.00015
Further Details:      
 
Domain Number 2 Region: 145-235
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000237
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 233-287
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000102
Family TSP-1 type 1 repeat 0.00083
Further Details:      
 
Domain Number 4 Region: 38-140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000913
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015259   Gene: ENSNLEG00000012553   Transcript: ENSNLET00000016031
Sequence length 836
Comment pep:known_by_projection supercontig:Nleu1.0:GL397498.1:542837:574327:1 gene:ENSNLEG00000012553 transcript:ENSNLET00000016031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLGPALLGIAASPLSASGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKPVLLVCK
AVPATQIFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLEEYWCQC
VAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAEVEWLRN
EDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVYVDGSWS
PWSKWSACGLDCTHWRSRECSDPAPRNGGEECQGADLDTRNCTSDLCVHTASGPEDVALY
VGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTI
QPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGGGRHTLHHSSPTSEAEEFVSRL
STQNYFRSLPRGTSNMTYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPE
DVRLPLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSCEGSWED
VLHLGEEAPSHLYYCQLEASACYVFTEQLGRFALVGEALSVAAAKRLKLLLFAPVACTSL
EYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLWKS
KLLVSYQEIPFYHIWNGTQQYLHCTFTLERVSPSTSDLACKLWVWQVEGDGQSFNINFNI
TKDTRFAELLALESEGGVPALVGPSAFKIPFLIRQKIISSLDPPCSRGADWRTLAQKLHL
DSHLSFFAAKPSPTAMILNLWEARHFPNGNLSQLAAAVAGLGQPDAGLFTVSEAEC
Download sequence
Identical sequences ENSNLEP00000015259 ENSNLEP00000015259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]