SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015282 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015282
Domain Number 1 Region: 813-866
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000446
Family Laminin-type module 0.00039
Further Details:      
 
Domain Number 2 Region: 869-917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family Laminin-type module 0.00085
Further Details:      
 
Domain Number 3 Region: 271-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000053
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 4 Region: 920-961
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000014
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 5 Region: 710-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 6 Region: 430-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 7 Region: 383-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number 8 Region: 327-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 9 Region: 758-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Laminin-type module 0.00062
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015282
Domain Number - Region: 85-159
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000612
Family CBM4/9 0.062
Further Details:      
 
Domain Number - Region: 968-1013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00226
Family Laminin-type module 0.027
Further Details:      
 
Domain Number - Region: 672-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00446
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015282   Gene: ENSNLEG00000012583   Transcript: ENSNLET00000016056
Sequence length 1578
Comment pep:known_by_projection supercontig:Nleu1.0:GL397403.1:668503:752219:1 gene:ENSNLEG00000012583 transcript:ENSNLET00000016056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALLLGLALLAPRASGAGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGAQCQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRNRADGPWEPYQFYSASCRKTYGRPEGQYLR
PGEEERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYFYAVSDFSVGGRCKCNGHASECGPDAAGQLACRCQHNTTGTD
CERCLPFFQDRPWARGTTEAAHECLPCNCSGRSEECTFDRELFRSTGHGGHCHHCRDHTA
GPHCEHCQENFYHWDPRMPCQPCDCHPAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPAGCSSC
FCYGHSKVCAATAQFQVHHILTDFHQGAEGWWARSVGGPEHPPQWSPNGVLLSPEDEEEL
TAPEKFLGDQRFSYGQPLILTFRMPPRDSPLPVQLRLEGAGLALSLRHSSLSGPQDARHP
REVELRFHLRATGEGDMVGSLEPGSRGCRVMINLWSLCLLSSSLPSRSAGQVFLTEVRLT
SARPGLSPPASWVETCSCPNGYTGQFCESCAPGYKREMPQGGPYASCVPCTCNQHGTCDP
NTGICVCSHHTEGPSCERCLPGFYGNPFAGQADDCQPCPCPGQSACTTIPENGEVVCTHC
PPGQRGRRCEVCDDGFFGDPLGLSGHPQPCHQCQCSGNVDPNAVGNCDPLSGHCLRCLHN
TTGDHCEHCQEGFYGSALVPRPADKCMPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTGRD
CSRCYPGFFDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCTCRPGVTGQACDRCQLGFFGF
SIKGCRACRCSPLGAASAQCHENGTCVCRPGFEGYKCDRCHDNFFLTADGTHCQECPSCY
ALVKEEAAKLKARLTLMEGWLQGSNCGSPWGPLDILLGEAPRGDVYQGHHLLPGAREAFL
EQMIGLEGAVKAAREQLQRLSKGARCAQAGAQKTCTQLADLEAVLESSEEEILHAAAILA
SLEIPQEGPGQPTKWSHLATEARALARSHRDTATKIVATARRALLASNTSYALLWNLLEG
RVALETQRDLEDRYQEVQAAQKALGTAMAEVLPEAESMLATVQQVGADTTPYLASLASPG
ALPQKSRAEDLGLKVKALEKTVASRQHMATEAARTLQAAAQAALRQTEPLTQLHQEARAA
LTQASSSVQAATVTVMGARTLLADLEGMKLQFPRPKDQAALQRKADSVSDRLLADMRKKT
KQVERMLGNAASLSSSAKKKGREAEVLAKDSAKLAKALLREGKQAQRRASRLTSQTQATL
QQASWQLLASEARRQELEEAERVGAGLSEMEQQIRESRISLEKDIEALSELLARLGSLDT
HQASAQALNETQWALERLRLQLGSPGALQRKLRLLEQESEQQELQIQGFESDLAEIRADK
QNLEAILHSLPENCASWQ
Download sequence
Identical sequences ENSNLEP00000015282 ENSNLEP00000015282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]