SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015336 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015336
Domain Number 1 Region: 111-223
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-29
Family C-type lectin domain 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015336   Gene: ENSNLEG00000012630   Transcript: ENSNLET00000016112
Sequence length 224
Comment pep:known_by_projection supercontig:Nleu1.0:GL397376.1:1737846:1742163:-1 gene:ENSNLEG00000012630 transcript:ENSNLET00000016112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRLLLLPVLLLGTVSALHLENDVPHLESLETQADLGQDLDSSKEQERDLALTEEIQAEG
EEVKASACQDTFEDEEAMESDPAALDKDFQCPREADIVEVQGSPRCKTCRYILVRTPTTF
AKAQNVCRRCYRGNLVSIHNFNFNYRIQCYTSTANQAQVWIGGILRGWFLWKRFCWTDGS
HWNFAYWSPGQPSNGRGCCVALCTKGGYWRRARCNKQLPFVCSF
Download sequence
Identical sequences G1RQ22
ENSNLEP00000015336 ENSNLEP00000015336 XP_003275351.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]