SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015341 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015341
Domain Number 1 Region: 149-200
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000051
Family TSP-1 type 1 repeat 0.00095
Further Details:      
 
Domain Number 2 Region: 225-288
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000863
Family Pre-dockerin domain 0.047
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015341
Domain Number - Region: 51-166
Classification Level Classification E-value
Superfamily Vitelline membrane outer protein-I (VMO-I) 0.00301
Family Vitelline membrane outer protein-I (VMO-I) 0.0079
Further Details:      
 
Domain Number - Region: 309-349,500-528
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00565
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015341   Gene: ENSNLEG00000012638   Transcript: ENSNLET00000016117
Sequence length 1182
Comment pep:known_by_projection supercontig:Nleu1.0:GL397307.1:8861823:8873398:-1 gene:ENSNLEG00000012638 transcript:ENSNLET00000016117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGTKAWVFSFLVLEVTSVLGRQTMLTQSVRRVQPGKRNPSIFAKPADTLESPGEWTTWF
NIDYPGGKGDYERLDAIRFYYGDRVCARPLRLEARTTDWTPAGSTGQVVHGSPREGFWCL
NREQRPGQNCSNYTVRFLCPPGSLRRDTEGIWSPWSPWSKCSAACGQTGVQTRTRTCLAE
TVSLCSEATEEGQHCMGQDCAACDLTCPMGQVNADCDACMCQDFMLHGAVSLPGGAPASG
ATVYLLTKTPKLLTQTDSDGRFRIPGLCPDGKSILKITKVKFAPIVRTMPKTSLKAATIK
AEFVRAETPYMVMNPETKARRAGQSVSLCCKATGKPSPDKYFWCLLALGLDLLIRTITNR
IKLQVRQWYRAQMLGLTNGSHGVGSQTTSKLSHSPDETPCNPVPESYLIRLPHDCFQNAT
NSFYYDVGRCPVKTCVGQQDNGIRCRDAVQNCCGISKTEEKEIQCSGYTLPTKVAKECSC
QRCTETRSIVRGRVSAADNGEPMRFGHVYMGNSRVSMTGYKGTFTLHVPQDTERLVLTFV
DRLQKFVNTTKVLPFNKKGSAVFHEIKMLRRKEPITLEAMETNIIPLGEMVGEDPMAELE
IPSRSFYRQNGEPYTGKVKASVTFLDPRNISTATAAQSDLNFINDEGDTFPLRTYGMFSV
DFRDEVTSEPLNAGKVKVHLDSTQVKMPEHISTVKLWSLNPDTGLWEEEGDFKFENQRRN
KREDRTFLVGNMEIRERRLFNLDVPESRRCFVKVRAYRSERFLPSEQIQGVVISVINLEP
RTGFLSNPRAWGRFDSVITGPNGACVPAFCDDQSPDAYSAYVLASLAGEELQAVESSPKF
NPNAIGVPQPYLNKLNYRRTDHEDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENLRAC
EEAPPSAAHFRFYQIEGDRYDYNTVPFNEDDPMSWTEDYLAWWPKPMEFRACYIKVKIVG
PLEVNVRSRNMGGTHRRTVGKLYGIRDVRSTRDRDQPNVSAACLEFKCSGMLYDQDRVDR
TLVKVIPQGSCRRASVNPMLHEYLVNHLPLAVNNDTSEYTMLAPLDPLGHNYGIYTVTDQ
DPRTAKEIALGRCFDGTSDGSSRIMKSNVGVALTFNCVERQVGRQSAFQYLQSTPARSPA
AGTVQGRVPSRRQQRASRGGQRQRGAVASLRFPTVAQQPLIN
Download sequence
Identical sequences ENSNLEP00000015341 ENSNLEP00000015341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]