SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015342 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015342
Domain Number 1 Region: 53-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000398
Family Spermadhesin, CUB domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015342   Gene: ENSNLEG00000012627   Transcript: ENSNLET00000016120
Sequence length 322
Comment pep:known_by_projection supercontig:Nleu1.0:GL397283.1:9321357:9338316:1 gene:ENSNLEG00000012627 transcript:ENSNLET00000016120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPNFKLQCHFILIFLTALRGESRYLELREAAEYDPFLLFSANLKRELAGEQPYRRALQC
LDMLSLQGQFTFTADRPQLHCAAFFIGEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPTAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNL
FPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGI
GDFVELLGGTGLDPSKMMPLADLCYSFHGPAQMKVGCDNTVVRVVSSGKHVNRVTFEYRQ
LEPYELENPNGNSIGEFCLSGL
Download sequence
Identical sequences G1RQ28
XP_003261543.1.23891 ENSNLEP00000015342 ENSNLEP00000015342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]