SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015348 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015348
Domain Number 1 Region: 954-1081,1113-1320
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-67
Family p120GAP domain-like 0.0004
Further Details:      
 
Domain Number 2 Region: 26-190
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-38
Family Calponin-homology domain, CH-domain 0.0000263
Further Details:      
 
Domain Number 3 Region: 1536-1569
Classification Level Classification E-value
Superfamily RGC domain-like 0.0000262
Family RGC domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015348
Domain Number - Region: 713-813
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000126
Family Motor proteins 0.038
Further Details:      
 
Domain Number - Region: 669-698
Classification Level Classification E-value
Superfamily WW domain 0.00022
Family WW domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015348   Gene: ENSNLEG00000012625   Transcript: ENSNLET00000016128
Sequence length 1572
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:7311994:7357407:-1 gene:ENSNLEG00000012625 transcript:ENSNLET00000016128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRAAGPGRAAYERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEACLKEELPSPVELEE
SLRNGVLLAKLGHCFAPSVVPLKKIYDVEQLRYQATGLHFRHTDNINFWLSAIAHIGLPS
TFFPETTDIYDKKNMPRVVYCIHALSLFLFRLGLAPQIHDLYGKVKFTAEELSNMASELA
KYGLQLPAFSKIGGILASELSVDEAAVHAAVLAINEAVERGVVEDTLAALQNPSALLENL
REPLAAVYQEMLAQAKMEKAANARNHDDRESQDIYDHYLTQAEIQGNINHVNVHGALEVV
DDALERQSPEALLKALQDPALALRGVRRDFADWYLEQLSSDREQKAQELGLVELLEKEEV
QAGVAAANTKGDQEQAMLHAVQRINKAIRRGVAADTVKELMCPEAQLPPVYPVASAMYQQ
ELTVLQRQQQGELGQEELFVAVEMLSAVVLINRALEARDASGFWSSLVNPATGLAEVEGE
NAQRYFDALLKLRQERGTGEDFLSWNDLQATVSQVNAQAQEETDRVLAVSLINEALDKGS
PEKTLSALLLPAAGLDDVSLPVAPRYHLLLVAAKRQKAQLYSDGHNGFWVGVRGAFQSGK
EGWPRCQGMALGVAAINQAIKEGKAAQTERVLRNPAVALRGVVPDCANGYQRALESVMAK
KQHPADTAFWVQHDMKDGTAYYFHLQTFQGIWEQPPGCPLNTSHLTREEIQLAVTKVTAA
YDRQQLWKANVSFVIQLQARLRGFLVRQKFAEYSHFLRTWLPAVIKIQAHWRGHRQRKIY
LERLQYFKANLDAIIKIQAWARMWAARRQYLRRLHYFQKNVNSIVKIQAFFRARKAQDYY
WILVHAPHPPLSVVRRFAHLLNQSQRDFLAEAELLKLQEEVVRKIRSNQQLEQDLNIMDI
KIGLLVKNRITLQEVVSHCKKLTKRNKEQLSDMMVLDKQKGLKSLSKEKRQKLETYQHLF
YLLQTQPIYLAKLIFQMPQNKTTKFMEAVIFSLYNYASSRREAYLLLQLFKTALQEEIKS
KVEQPQDVVTGNPTVVRLVVRFYRNGRGQSALQEILGKVIQDVLEDKVLSVHTDPVHLYK
NWINQTEAQTGQRSHLPYDVTLEQALSHPEVQRRLDIALRNLLAMTDKFLVAITSSVDQI
PYGMRYVAKVLKATLAEKFPDATDSEVYKASVVGNLLYYRFLNPAVVAPDAFDIVAVAAG
GALAAPQRHALGAVAQLLQHAAAGKAFSGQSQHLRVLNDYLEETHLKFRKFIHRACQVPE
PEERFAVDEYSDMVAVAKPVVYITVGELVNTHRLLLEHQDCIAPDHQDPLHELLDDLGEL
PTIPDLIGESIAADGHTDLSKLEVSLTLTNKFEGLEADADDSNTRSLLLSTKQLLADIIQ
FHPGDTLKEILSLSASREQEAAHKQLMSRRQACTAQTPEPLRRHRSLTAHSLLPLAEKQR
RVLRNLRRLEALGLVSARNGYQGLVDELAKDIRNQHRHRHRRKAELVKLQATLQGLSTKT
TFYEEQGDYYSQYIRACLDHLAPDSKSSGKGKKQPSLHYTAAQLLEKGVLVEIEDLPASH
FRNVIFDITPGY
Download sequence
Identical sequences ENSNLEP00000015348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]