SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015352 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015352
Domain Number 1 Region: 458-742
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.51e-68
Family Protein kinases, catalytic subunit 0.00000000252
Further Details:      
 
Domain Number 2 Region: 142-242
Classification Level Classification E-value
Superfamily Immunoglobulin 5.75e-21
Family I set domains 0.000078
Further Details:      
 
Domain Number 3 Region: 249-350
Classification Level Classification E-value
Superfamily Immunoglobulin 1.97e-19
Family I set domains 0.0000399
Further Details:      
 
Domain Number 4 Region: 34-107
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000486
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015352   Gene: ENSNLEG00000012632   Transcript: ENSNLET00000016134
Sequence length 801
Comment pep:known_by_projection supercontig:Nleu1.0:GL397498.1:788838:796684:1 gene:ENSNLEG00000012632 transcript:ENSNLET00000016134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPTGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLIIDDS
STSSNDDEDPKSHRASSNRHIYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP
TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD
VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP
YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWAA
AVPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL
ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ
VVRAEAFGMDPAWPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC
TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM
QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGIHHIDYYKKTSNGRLPVKWMAPEA
LFDRVYTHQSDVVLPAXXXXXXXXXGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYGL
MRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSASGGDASSTCSSSDSV
FSHDPLPLGSSSFPFGSGVQT
Download sequence
Identical sequences ENSNLEP00000015352 ENSNLEP00000015352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]