SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015361 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015361
Domain Number 1 Region: 420-602
Classification Level Classification E-value
Superfamily Fibronectin type III 3.99e-36
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 326-421
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-26
Family I set domains 0.0065
Further Details:      
 
Domain Number 3 Region: 235-326
Classification Level Classification E-value
Superfamily Immunoglobulin 3.53e-17
Family I set domains 0.0041
Further Details:      
 
Domain Number 4 Region: 44-134
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.0099
Further Details:      
 
Domain Number 5 Region: 113-193
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000284
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015361   Gene: ENSNLEG00000012651   Transcript: ENSNLET00000016143
Sequence length 804
Comment pep:known_by_projection supercontig:Nleu1.0:GL397307.1:8995395:9044994:-1 gene:ENSNLEG00000012651 transcript:ENSNLET00000016143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVQRAASPRRPPAPRWSRLLLPLLLLLLPAPSEGLGHSAELAFALEPSDDVAVPGQPIV
LDCGVEGTPPVRITWRKNGVELPESTHSTLLANGSLMIRHFRLERGGSPSDEGDYECVAQ
NRFGLVVSRKARIQAATMSDFHVHPQATVGEEGGVARFQCQIHGLPKPLITWEKNRVPID
TDNERYTLLPKGVLQTASSSSLPLDQLPSAGLCSLLSHSARLTVSGSGSGAYKEPAILVG
PENLTLTVHQTAVLECVATGNPRPIVSWSRLDGRPIGVEGIQVLGTGNLIISDVTVQHSG
VYVCAANRPGTRVRRTAQGRLVVQAPAEFVQHPQSISRPAGTTAMFTCQAQGEPPPHVTW
LKNGQVLGPGGHVRLKNNNSTLTISGIGPEDEAIYQCVAENSAGSSQASARLTVLWAEGL
PGPPRNVRAVSVSSTEVRVSWSEPLANTKEIIGYVLHIRKAADPPELEYQEAVSKSTFQH
LVSDLEPSTAYSFYIKAYTPRGASSASVPTLASTLGEAPAPPPLSVRVLGSSSLQLLWEP
WPRLAQHEGGFKLFYRPASKTSFTGPILLPGTVSSYNLSQLDPTTVYEVKLLAYNQHGDG
NATVRFVSLRGASERTALSPPCDCRKEEAANQTSTTGIVIGIHIGVTCIIFCVLFLLFGQ
RGRVLLCRCGNQLSPPQGPRSQRDPGILLNGARRGERGQLGQDEKRVDMKELEQLFPRAG
AAGQPDPRPTQDPAAPAPFEETQLSVLPLQGCGLMEGKTTEATAPCAGLAAAPPPPDGGP
GLLSEGQASRPAAARVTQPAHLEQ
Download sequence
Identical sequences ENSNLEP00000015361 ENSNLEP00000015361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]