SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015389 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015389
Domain Number 1 Region: 410-603
Classification Level Classification E-value
Superfamily Fibronectin type III 2.95e-40
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 2 Region: 730-926
Classification Level Classification E-value
Superfamily Fibronectin type III 1.99e-39
Family Fibronectin type III 0.00052
Further Details:      
 
Domain Number 3 Region: 127-213
Classification Level Classification E-value
Superfamily Immunoglobulin 2.96e-21
Family I set domains 0.037
Further Details:      
 
Domain Number 4 Region: 310-405
Classification Level Classification E-value
Superfamily Immunoglobulin 6.55e-21
Family I set domains 0.002
Further Details:      
 
Domain Number 5 Region: 227-322
Classification Level Classification E-value
Superfamily Immunoglobulin 4.39e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 6 Region: 611-709
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000117
Family Fibronectin type III 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015389
Domain Number - Region: 29-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000108
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015389   Gene: ENSNLEG00000012668   Transcript: ENSNLET00000016175
Sequence length 1232
Comment pep:known_by_projection supercontig:Nleu1.0:GL397307.1:9048837:9078982:-1 gene:ENSNLEG00000012668 transcript:ENSNLET00000016175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLYAGELLLPQETTVELSCGVGPLQVILGPEQAAVLNCSLGAAAAGPPTRVTWSKDGDT
LLEHDHLHLLPNGSLWLSQPLAPNGSDESVPEAVGVIEGSYSCLAHGPLGVLASQTAVVK
LATLADFSLHPESQTVEENGTARFECHIEGLPAPIITWEKDQVTLPEEPRLITLPNGVLQ
ILDVQESDAGPYRCVATNSARQRFSQEALLSVARRGFLASTRGQDVVIVAAPENTTVVSG
QSVVMECVASADPTPFVSWVRQDGKPISTDVIVLGRTNLLIASTQPWHSGVYVCRANKPR
TRDFATAAAELRVLAAPAITQAPEALSRTRASTARFVCRASGEPRPALRWLHNGAPLRPN
GRVKVQGGGGGLVITQIGLQDAGYYQCVAENSAGMACAAASLAVIVREGLPSAPTRVTAT
PLSSSAVLVAWERPELHSEQIIGFSLHYQKARGMDNVEYQFAVNNDTTELQVRDLEPNTD
YEFYVVAYSQLGASRTSTPALVHTLDDVPSAAPQLSLSSPNPSDIRVAWLPLPPSLSNGQ
VVKYKIEYGLGKEDQIFSTEVRGNETQLMLNSLQPNKVYRVRISAGTAAGFGAPSQWMQH
RTPSMHNQSHVPFAPAELKVQAKMESLVVSWQPPPHPTQISGYKLYWREVGAEEEANGDR
PPGGRGDQAWDVGPVRLKKKVKQYELTQLVPGRLYEVKLVAFNKHEDGYAAVWKGKTEKA
PAPDMPIQRGPPLPPAHVHAESNSSTSIWLRWKKPDFTTVKIVNYTVRFSPWGLRNASLV
TYYTSSGEDILIGGLKPFTKYEFAVQSHGVDMDGPFGSVVERSTLPDRPSTPPSDLRLSP
LTPSTVRLHWCPPTEPNGEIVEYLILYSNNHTQPEHQWTLLTTEGNIFSAEVHGLESDTR
YFFKMGARTEVGPGPFSRLQDVITLQEKLSDSLDMHSVTGIIVGVCLGLLCLLACMCAGL
RRSPHRESLPGLSSTATPGNPALYSRARLGPPSPPAAHELESLVHPHPQDWSPPPSDVED
RAEVHSLMGGGISEGRSHSKRKISWAQPSGLSWAGSWAGCELPQAGPRPALTRALLPPAG
TGQTLLLQALVYDAIKGNGRKKSPPACRNQVEAEVIVHSDFSASNGNPDLHLQDLQPEDP
LPPEAPDLISGVGDPGQGAAWLDRELGGCELAAPGPDRLTGLPEAASASCSYPDLQPGEV
LEGTPGDSCQLKAPCPLGASPGLPRSPVSSSA
Download sequence
Identical sequences ENSNLEP00000015389 ENSNLEP00000015389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]