SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015404 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015404
Domain Number 1 Region: 27-196
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.76e-44
Family Dual specificity phosphatase-like 0.0000000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015404   Gene: ENSNLEG00000012673   Transcript: ENSNLET00000016191
Sequence length 212
Comment pep:known_by_projection supercontig:Nleu1.0:GL397312.1:5139506:5163436:1 gene:ENSNLEG00000012673 transcript:ENSNLET00000016191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPSSIQTSEFDSSDEEPIEDEQTPIQISWLSLSRVNCSQFLGLCALPGCKFKDVRRNV
QKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCC
EIMEELTICLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAI
QTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Download sequence
Identical sequences A0A096NV50 A0A2K5WR43 A0A2K6D1W7 F7FIB7 H2NLA0
ENSNLEP00000015404 NP_001247846.1.72884 XP_002824801.1.23681 XP_003267755.1.23891 XP_005561346.1.63531 XP_011739844.1.29376 ENSPPYP00000006621 ENSPANP00000016925 9544.ENSMMUP00000016171 9600.ENSPPYP00000006621 ENSNLEP00000015404 ENSPPYP00000006621 ENSMMUP00000016171 ENSMMUP00000016171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]