SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015414 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015414
Domain Number 1 Region: 163-324
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-44
Family MAM domain 0.00091
Further Details:      
 
Domain Number 2 Region: 604-764
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-34
Family MAM domain 0.0016
Further Details:      
 
Domain Number 3 Region: 389-555
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.75e-34
Family MAM domain 0.0049
Further Details:      
 
Domain Number 4 Region: 1096-1260
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.17e-31
Family MAM domain 0.00077
Further Details:      
 
Domain Number 5 Region: 2-116
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-18
Family MAM domain 0.013
Further Details:      
 
Domain Number 6 Region: 561-601
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 345-387
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 779-818
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 9 Region: 1054-1090
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000038
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 10 Region: 1272-1309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 11 Region: 1313-1351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 12 Region: 818-861
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000739
Family MAM domain 0.027
Further Details:      
 
Domain Number 13 Region: 126-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number 14 Region: 1355-1392
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000223
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015414
Domain Number - Region: 918-977
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000301
Family MAM domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015414   Gene: ENSNLEG00000012702   Transcript: ENSNLET00000016201
Sequence length 1484
Comment pep:novel supercontig:Nleu1.0:GL397271.1:17918965:18466941:1 gene:ENSNLEG00000012702 transcript:ENSNLET00000016201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STGHFMFILKKSSSLWQVAKLQSPTFSQTGPGCILSFWFYNYGLSVGAAELQLHMEKSHD
STVIWRVLYNQGKKWSKATIQLGRLSQPFHLSLDKVSLGIYDGVSAIDDIRFDNCTLPLP
AESCEGLDHFWCRHTRACIEKLRLCDLVDDCGDRTDEVNCAPELQCNFENGICNWEQDAK
DDFDWTRNQGPTPTLNTGPLKDNTLGTAKGHYLYIESSEPQAFQDSAALLSPILNATDTK
GCTFRFYYHMFGKRIYRLAIYQRIWSDSRGQLLWQIFGNQGNRWIRKHLNISSRQPFQLL
LEASVGDGFTGDIAIDDLSFMDCTLYPGNLPADLPTPPETSVPVTLPPHNCTDNEFVCRS
DGHCIEKMQKCDFKYDCPDKSDEASCVMEVCSFEERSLCNWYQPIPVHLLQDSNTFRWGL
GNGISVHHGEENHRPSVDHTQNTTDGWYLYADSSNGKFGDMADILTPIISLTGPKCTLVF
WTHMNGATVGSLQVLIKKDNITSKLWAQTGRQGARWKRVEVFLGIHSHTQIVFRAKRGIS
YIGDVAVDDISFQDCSPLLSPERKCTAHEFMCANKHCIAKDKLCDFVNDCADNSDETTFI
CRTSSGRCDFEFDLCSWEQEKDEDFDWNLKASSIPAAGTEPAADHTLGNSSGHYIFIKSL
FPQQPMRAARISSPVISKRSRNCKIIFHYHMYGNGIGALTLMQVSVTNQTKVLLNLTVEQ
GNFWRREELSLFGDEDFQLKFEGRVGKGQRGDIALDDIVLTENCLSLHESMQEELAVPLP
TGFCPFGYWECQNGKCYGLEQSCNFVDDCGDNTDENECGSSCTFENGWCGWQNSLADNFD
WVLGVGSQQSLRPPRDHTLGNENAVLLMRRHKYPIRSVNLHTVKHVLKAQTVGNCSVKLE
ARLLDILSVPNENAFGSSDHMNWHFMYLEATAVGLQGDRAHFRSTMWRESSASCSMGFWY
FISAKATGSIQILIKGGRRRRQAPNSVPSGSPTIPRQGSQQLEGWRSGSARHRARALPEP
ECPRGRSAPLKGPPKEEPNRRSALLSVGEISEICPETTDFLCRDKKCIASHLVCDYKPDC
FDRSDEAHCAQYTSTTGSCNFETSSGNWTTACSLTQDSEDDLDWAIGSRIPAEALIPDSD
HTPGSGQHFLYVNSSGSKEGSIARITTSKFFPASLGMCTVRFWFYMIDPRNMGILKVYTI
EESGLNILVWSVIGNKRSGWTYGYVPLSSNSPFKVAFEADLDGNEDIFIALDDISFTPEC
VTGGPVPVQPSPCEADRFSCIYTLQCVPLSGKCDGHEDCIDGSDEMDCPVSPTPPLCSNM
EFACSTDECIPSFLLCDGVPDCHFNEDELICSNKSCSNGALVCASSNSCIPAYQRCDGFA
DCMDFQLDESSCSDIWTILGIGLAFLMTHITVAVLCFLANRKVPIRKTEGSGNCAFVNPV
YGNLSNPEKTESSVYSFSNPLYGTTPGSVETLSHHLKQQHRDQV
Download sequence
Identical sequences ENSNLEP00000015414 ENSNLEP00000015414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]