SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015417 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015417
Domain Number 1 Region: 109-221
Classification Level Classification E-value
Superfamily C-type lectin-like 5.95e-29
Family C-type lectin domain 0.000000967
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015417   Gene: ENSNLEG00000026666   Transcript: ENSNLET00000016205
Sequence length 222
Comment pep:known_by_projection supercontig:Nleu1.0:GL397376.1:1748695:1752029:-1 gene:ENSNLEG00000026666 transcript:ENSNLET00000016205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEVEETPSRELEEEEEW
GSGSEDASKEDGAVESILVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFNQ
AWLTCQRCYGGNLASIHNFNTNYRIQCSVSGLNQGQVWIGGRITGSGRCRHLQWVDGSRW
NFAYWAARQPWSRGGHCVSLCTRGGHWRRAHCLRRLPFICSY
Download sequence
Identical sequences G1RQA3
ENSNLEP00000015417 XP_003275352.1.23891 XP_003275354.1.23891 XP_012354084.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]