SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015448 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015448
Domain Number 1 Region: 397-800
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-134
Family Ankyrin repeat 0.0000000000003
Further Details:      
 
Domain Number 2 Region: 41-415
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.42e-115
Family Ankyrin repeat 0.00000017
Further Details:      
 
Domain Number 3 Region: 1385-1469
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-22
Family DEATH domain, DD 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015448   Gene: ENSNLEG00000012608   Transcript: ENSNLET00000016236
Sequence length 1830
Comment pep:known_by_projection supercontig:Nleu1.0:GL397325.1:11922105:12027296:-1 gene:ENSNLEG00000012608 transcript:ENSNLET00000016236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKE
IILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVK
FLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRT
AAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASR
RGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSP
IHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA
LNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQQRA
SPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKL
LLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGK
VRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHI
AAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSG
LTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHRADVN
AKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKV
VTDETSFVLVSDKHRMSFPETVDEILDVSEDEGEELIGSKAERQDSRDVDEEKELLDFVP
KLDQVVESPAIPRIPCVMPETVVIRSEEQEQVRSSFSVVSPRGEHEGCRSPTCICPTPRF
LVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLSTPPPLAEEEGLAS
RIIALGPTGAQFLSPVIVEIPHFASHGRGDRELVVLRSENGSVWKEHRSRYGESYLDQIL
NGMDEELGSLEELEKKRVCRIITTDFPLYFVIMSRLCQDYDTIGPEGGSLKSKLVPLVQA
TFPENAVTKRVKLALQATLPQDIPTLLSGALKCHSGDLKFETRLTNMEKPPEIIPLHCSL
GNKRRAEGEGSSMLTPISAGVTGGTDQAQWEDITGTTKLVYANECANFTTNVSARFWLSD
CPRTAEAVNFATLLYKELTAVPYMAKFVIFAKMNDPREGRLRCYCMTDDKVDKTLEQHEN
FVEVARSRDIEVLEGMSLFAELSGNLVPVKKAAQQRSFHFQSFRENRLAMPVKVRDSSRE
PAGSLSFLRKAMKYEDTQHILCHLNITMPPCTKGSGAEDRRRTPTPLSLRYSILSESTPG
FLSGTDQPEMKMAVISEHLGLSWAELARELQFSVEDINRIRVENPNSLLEQSVALLNLWV
IREGQNAKMENLCTALQSIDRGEIVNMLEGSGRQSRNLKPDRRHTDRDYSLSPSQINGYS
SLQDELLSPASLGCALSSPLRADQYWNEVADSSLECSKAEDSDATGHEWKLEGALSEEPR
GPELGSLELVEDDTVDSDATNGLIDLLEQEEGQRSEEKLPGSKRQDDATGAGQDSENEVS
LVSGHQRRQARITHSPTVSRVTERSQDRLQDWDADGSIVSYLQDAAQGSWREEVTQGPHS
FQRTSTMTEGLEPSGSQEYEKVLVSVSEYTRTEQPEAESSQEDRDRRQQGQEEQVQEAEN
TFTQVVQGNEFQNIPGEQVTEEQFTDEQGNIVTKKVAIKVVEASSFSLLPSQQELGALVI
CSPVMDPSELEVDIDSFMKQAKDHTSTPNP
Download sequence
Identical sequences ENSNLEP00000015448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]