SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015499 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015499
Domain Number 1 Region: 7-86
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-19
Family PDZ domain 0.00056
Further Details:      
 
Domain Number 2 Region: 358-422
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.25e-18
Family LIM domain 0.013
Further Details:      
 
Domain Number 3 Region: 300-362
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000953
Family LIM domain 0.034
Further Details:      
 
Domain Number 4 Region: 418-443
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000598
Family LIM domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015499   Gene: ENSNLEG00000012737   Transcript: ENSNLET00000016287
Sequence length 448
Comment pep:known_by_projection supercontig:Nleu1.0:GL397498.1:1218871:1235102:-1 gene:ENSNLEG00000012737 transcript:ENSNLET00000016287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGS
LTHIEAQNKIRACGERLSLGLSRAQPVQSKQQKASAPAADPPRYTFAPSVSLNKTARPFG
APPPADSAPQQNGPPVAPRPLPAAAQSVLRPSPAEPPRPSAGGWGADLSPAVLTPPRLSS
SPVSVSFSRVSHGHLSLHEAPVATLPPGVLPATASPVTSRSVWRAGSASFMAATVTSQAY
LLLYVRNELSPKPSRWVVSQPEGGPRPPPLCMCSLSPLSPPCRGRYLVALGHAYHPEFVC
SQCGVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTWHVHCFTCAA
CKTPIRNRAFYMEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFSWHDTCFVCA
ICQINLEGKTFYSKKDRPLCKSHAFSHV
Download sequence
Identical sequences ENSNLEP00000015499 ENSNLEP00000015499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]