SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015550 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015550
Domain Number 1 Region: 951-1244
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-76
Family Protein kinases, catalytic subunit 0.00000000125
Further Details:      
 
Domain Number 2 Region: 322-484
Classification Level Classification E-value
Superfamily L domain-like 3.12e-44
Family L domain 0.00000247
Further Details:      
 
Domain Number 3 Region: 28-161,222-237
Classification Level Classification E-value
Superfamily L domain-like 2.1e-37
Family L domain 0.00000357
Further Details:      
 
Domain Number 4 Region: 482-602
Classification Level Classification E-value
Superfamily Fibronectin type III 1.73e-23
Family Fibronectin type III 0.00003
Further Details:      
 
Domain Number 5 Region: 767-910
Classification Level Classification E-value
Superfamily Fibronectin type III 3.46e-23
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 6 Region: 604-672,773-795
Classification Level Classification E-value
Superfamily Fibronectin type III 8.76e-18
Family Fibronectin type III 0.00027
Further Details:      
 
Domain Number 7 Region: 191-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000143
Family Growth factor receptor domain 0.0000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015550   Gene: ENSNLEG00000012803   Transcript: ENSNLET00000016339
Sequence length 1301
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:7630133:7647696:-1 gene:ENSNLEG00000012803 transcript:ENSNLET00000016339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPSLWPWGACLPVIFLSLGFGLDTVEVCPSLDIRSEVAELRQLENCSVVEGHLQILLM
FTATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGTRLFLGYALVIFEM
PHLRDVALPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPGANHIVGNKLGEECADVC
PGVLGAAGEPCARTTFSGHTDYRCWTSSHCQRVCPCPHGLACTARGECCHTECLGGCSQP
EDPRACVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPGRTSTFGIHQGSC
LAQCPSGFTRNSSSIFCHKCEGLCPKECKVGTKTIDSIQAAQDLVGCTHVEGSLILNLRQ
GYNLEPQLQHSLGLVETITGFLKIKHSFALVSLGFFKNLKLIRGDAMVDGNYTLYVLDNQ
NLQQLGSWWAAGLTIPVGKIYFAFNPRLCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRA
ACQTRTLRFVYNVTEADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGT
QSWNLLDVELPLSRTQEPGVTLASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIVYLRT
LPAAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNLTYYLVLWQRLAEDGDLYLNDYCHRG
LRLPTSNNDPRFDREDGDPEAEVESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNA
ITIPMCEERARPVRLALPRDSGRHRRAAGPLRLGGNSSDFEIQEDKVPRERAVLSGLRHF
TEYRIDIHACNHAAHTVGCSAATFVFARTMPHRGADGIPGKVAWEASSKNSVLLRWLEPP
DPNGLILKYEIKYRRLGEEATVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGS
WTDSVAFYILGPEEEDAGGLHVLLTATPVGLTLLIVLAALGFFYGKKRNRTVYASVNPEY
FSASDMYVPDEWEVSREQISIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELAS
PRERIEFLKEASVMKAFKCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSHLRSLRPEAEN
NPGLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDV
YETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIATLAEQPYQGLSNEQ
VLKFVMDGGVLEELEGCPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELRPSFRLLSFY
YSPECRGARGSLPPTDVDPDSSPNPRGASSDCSPQNGGPGY
Download sequence
Identical sequences ENSNLEP00000015550 ENSNLEP00000015550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]