SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015558 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015558
Domain Number 1 Region: 475-767
Classification Level Classification E-value
Superfamily Folate-binding domain 7.38e-85
Family Aminomethyltransferase folate-binding domain 0.0000286
Further Details:      
 
Domain Number 2 Region: 52-265,376-440
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.17e-57
Family FAD-linked reductases, N-terminal domain 0.00043
Further Details:      
 
Domain Number 3 Region: 265-375
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.71e-29
Family L-aminoacid/polyamine oxidase 0.0075
Further Details:      
 
Domain Number 4 Region: 769-855
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 3.6e-22
Family Aminomethyltransferase beta-barrel domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015558   Gene: ENSNLEG00000012801   Transcript: ENSNLET00000016348
Sequence length 866
Comment pep:known_by_projection supercontig:Nleu1.0:GL397283.1:11403549:11472421:-1 gene:ENSNLEG00000012801 transcript:ENSNLET00000016348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRPGAQWLRGLLLRNCPRQGSPGRPRSVCGREGEEKPPLSAETQWKDRAETVIIGGGCV
GVSLAYHLAKAGMKDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYEKLE
EETGQVVGFHQPGSIRLATTPVRVDEFKYQMTRTGWHATEQYIIEPEKIQEMFPLLNMNK
VLAGLYNPGDGHIDPYSLTMALAAGARKYGALLKYPAPVTSLKARSDGTWDIETPQGSMR
ANRIVNAAGFWAREVGKMVGLEHPLIPVQHQYVVTSTIPEVKALKRELPVLRDLEGSYYV
RQERDGLLFGPYESQEKMKVQDSWVTDGVPPGFGKELFESDLDRIMEHIKVAMEMVPVLK
KADIINVVNGPITYSPDILPMVGPHQGVRNYWVAIGFGYGIIHAGGVGKYLSDWILHGEP
PFDLIELDPNRYGKWTTTQYTEAKARESYGFNNIVGYPKEERFAGRPTQRVSGLYQRLES
KCSMGFHAGWEQPHWFYKPGQDTQYRPSFRRTNWFEPVGSEYKQVMQRVGVTDLSPFGKF
NIKGQDSIRLLDHLFANVIPKVGFTNISHMLTPKGRVYAELTVSHQSPGEFLLITGSGSE
LHDLRWIEEEAVKGGYDVEIKNITDELGVLGVAGPQARKVLQKLTSEDLSDDVFKFLQTK
FLKVSSIPVTATRISYTGELGWELYHRREDSLALYDAIMNAGQEEGIDNFGTYAMNALRL
EKAFRAWGLEMNCDTNPLEAGLEYFVKLNKPADFIGKQALKQIKAKGLKRRLVCLTLATD
DVDPEGNESIWYNGKVVGNTTSGSYSYSIQKSLAFAYVPVELSEVGQQVEVELLGKNYPA
VIIREPLVLTEPTRNRLQKKGGKDKN
Download sequence
Identical sequences G1RQP4
ENSNLEP00000015558 XP_003261560.1.23891 ENSNLEP00000015558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]