SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015604 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015604
Domain Number 1 Region: 477-762
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-81
Family Protein kinases, catalytic subunit 0.000000157
Further Details:      
 
Domain Number 2 Region: 45-168
Classification Level Classification E-value
Superfamily L domain-like 8.08e-23
Family Ngr ectodomain-like 0.000000578
Further Details:      
 
Domain Number 3 Region: 272-363
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000124
Family I set domains 0.00000372
Further Details:      
 
Domain Number 4 Region: 177-272
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000206
Family I set domains 0.00000938
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015604   Gene: ENSNLEG00000012811   Transcript: ENSNLET00000016397
Sequence length 779
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:7649734:7673490:1 gene:ENSNLEG00000012811 transcript:ENSNLET00000016397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELHIENQQ
HLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQG
LSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMNNASCGVPTLK
VQVSNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSD
LNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLF
NGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAA
FMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLL
MLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYF
SDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEVSESARQDF
QREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDV
APGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYS
TDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAI
DCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
Download sequence
Identical sequences ENSNLEP00000015604 ENSNLEP00000015604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]