SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015626 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000015626
Domain Number - Region: 400-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 267-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family Laminin-type module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015626   Gene: ENSNLEG00000012856   Transcript: ENSNLET00000016419
Sequence length 1074
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:7685494:7708927:1 gene:ENSNLEG00000012856 transcript:ENSNLET00000016419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEEGTLAASLAVQSSSSQTPAVPTPGSRKDGAPRQASAMSPPLCPLLLAVGLQLAGTLNP
SDPNTCSFWESFTTTTKESHSRPFSLLPSEPCERPWEGPHTCPQPTVVYRTVYRQVVKTD
HRQRLQCCHGFYESRGFCVPLCAQECVHGRCVAPNQCQCVPGWRGDDCSSGGAPGMWGPQ
CDKPCSCGNNSSCDPKSGVCSCPSGLQPPNCLQPCTPGYYGPACQFRCQCHGAPCDPQTG
ACFCPAERTGPSCDVSCSQGTSGFFCPSTHPCQNGGVFQTPQGSCSCPPGWMGTICSLPC
PEGFHGPNCSQECRCHNGGLCDRFTGQCRCAPGYTGDRCREECPVGRFGQDCAETCDCAP
DARCFPANGACLCEHGFTGDRCTDRLCPDGFYGLSCQAPCTCDPEHSLSCHPMNGECSCL
PGWAGLHCNESCPQDTHGPGCQEHCLCLHGGVCQATSGLCQCAPGYRGPHCASLCPPDTY
GVNCSARCSCENAIACSPIDGECVCKEGWQRGNCSVPCPPGTWGFGCNASCQCAHEAVCS
PQTGACTCTPGWHGAHCQLPCPKGQFGEGCASRCDCDHSDGCDPVHGRCQCQAGWMGARC
HLSCPEGLWGVNCSNTCTCKNGGTCLPENGNCVCAPGFRGPSCQRSCQPGRYGKRCVPCK
CANHSFCHPSNGTCYCLAGWTGPDCSQPCPPGHWGENCAQTCQCHHGGTCHPQDGSCICP
PGWTGHHCLEGCPLGTFGANCSQPCQCGPGEKCHPETGACVCPPGHSGAPCRIGIQEPFT
VMPTTPVAYNSLGAVIGIAVLGSLVVALVALFIGYRHWQKGKEHHHLAVAYSSGRLDGSE
YVMPDVPPSYSHYYSNPSYHTLSQCSLNPPPPNKVPGLLFASLKGPERPGGAQGHDNHTT
LPADWKHRREPPPGPLDRGSSRLDRSYSYSYSNGPGPFYNKGLISEEELGASVASLSSEN
PYATIRDLPSLPGGPRESSYMEMKGPPSGSPPRQPPQFWDSHRRRQPQPQRDSGTYEQPS
PLIHDRDSVGSQPPLPPGLPPGHYDSPKNSHIPGHYDLPPVRHPPSPPLRRQDR
Download sequence
Identical sequences ENSNLEP00000015626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]