SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015668 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015668
Domain Number 1 Region: 3741-3903
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-32
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 3545-3736
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-21
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 3 Region: 3349-3398
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000032
Family B-box zinc-binding domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015668
Domain Number - Region: 3383-3503
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0424
Family BAR domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015668   Gene: ENSNLEG00000012895   Transcript: ENSNLET00000016464
Sequence length 3910
Comment pep:known_by_projection supercontig:Nleu1.0:GL397283.1:12170104:12233759:1 gene:ENSNLEG00000012895 transcript:ENSNLET00000016464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTVQREDSGITWETNSSRSSTPWASEESQTSGVCSREGSTVNSPPGNVSFIVDEVKKVR
KRTPKSKHGSPSLRRKGNKKRKSFESQGIPTNKKGSPLTSASQVLTTEKEKSYTGIYDKA
RKKKTTSNTPPITGAIYKEHKPLVLRPVYIGTVQYKIKMFNLVKEELIPLQFYGTLPKGY
VIKEIHYRKGKDASISLEPDLDNSGSNTVSKTSKLVAQSIEDKVKEVVPPWRGALSKGSE
SLTLMFTHEDQKKIYADSPLNATSALEHTVPSYSSSDRAEQGIQLRYSQSVPQQPEDEAK
PHEVEPPSVTPDTPATMFLRTTKEECELASPGTAASENDSSVSPSFANEVKKEDVYSAHH
SISLEAASPGLAASTQDGLDPDQEQPDLTSIERAEPVSAKLTPTHPSVKGEKEENMLEAS
ISLSEPLMLEEPEKEEIETSLPIAITPEPEDSNLVEEGIIELDYPEGPLVSEKPFPPHVS
PELEHKEEELILPLLTTSTPEHVALSEEEREEIASVSTDSAFVSEYSVPQDLNHELQERE
GEPVSPSNVEAIAEHAVLSEEENEEFEAYSPAAAPASELSLSPFTTEKTSESQSPLFSTV
TPEHMVLSGDEASESGCYTPDSTSASEYSVPSEATKESLKKTTDRKSPLISKGVSEHMIP
SEEKEDTGSFTPAMASASEPSLSPSTTEKTSECQSPLPSTATSEHVVPSEGEDLGSERFT
PDSKLISKYAAPLNATQESQKKIIDEASQFKPKGISEHTVVSVEGKEDIGPSSPDLVVAS
EHSFPPHTTEMTSECQAPPLSATPSEYVVLSDEEAVELERYTPSSTSASEFSVPPYATPE
AQEEEIVHRSLNLKGASSPMNLSEEDQEDIGPFSPDSAFVSEFSFPPYATQEAEKREFEC
DSPICLTSPSEHTILSDEDTEEVELFSPDSASQVSVPPFRISETEKNELEPDSLLTAVSA
SGYSCFSEADEEDIGSTAATPVSEQFSSSQKQKAETFLLMSPLEDLSLPPSTDKSEKAEI
KPEIPTTSTSVSEYLILAQKQKAQAYLEPESEDLIPPHITSEVEKGEREASSSVAAIPAS
LPAQSPIVKEETKPASPHSVLPDSVPAIKKEQELTAALTLKAADEQMALSKVRKEEIVPD
SQEATAHVSQVKKMEPQPPNVPGSEMKYSVLPDVVDEPKKGVKPKLVLNVTSELEQRKLS
KNEPEVIKPYSPLKETSLSGPEVLSAVQMEMKHDSKITTTPTVLHSASSGVEKQVEHGPP
ALAFSALSEEIKKEIEPSSSTTTASVTKLDSNLTKVVKEEISTDSSLVTPVDRRVLTKVV
KGESGSGLPPLVTSADEHSVLAEEDKVAIKGASPIETSSKHLAWSEAEKEIKFDSPPSVS
SIAEHSVLPEVEAKEAKAGLPVIKTSSFQHSDESEEARVEDKQDLSFSTVRDSERLVSSQ
KKSLVSTSEVLGPEHELSLSLWGEIKKEETELPSSQNVSPASKHIIPKGKDEEIASSPPE
LENLASGLAPTLLLLSDDKNKQAVEVSSTAQGDFPSEKQDIALAELSLEPEKKDKPHQLS
ELPNAGSEFSSDLGRQSGSIGTKQAKSPITETEDSVLEKGPAELRSREGKEENRELYASS
TMPAISELSSLLREESQNEGIKPFSPKIVSLESKEPPASVAEGGNPEEFQPFTFSLKGLS
EEVSHPADFKKGGNQEIGPLPPTGNLKAQVMGDILDKLSEETGHPAPSRVLQSITEPSKI
APSDLLVEQKKTEKALHSDQTVKLPDVSTSFEDKQDLGIKQFSFMRENLPLEQSKSFMTT
KPADVKETKMEEFFISPKGENWMLGKPENVASQHEERIAGSVQLDSSGSNELRPGQLKAA
VSSEDHTYEVRKQVLPHSAEESHLSSQEAVSALDTSSGNVETLSSKSYSSEEVKLAEEPK
SLVLAGNVERNIAEGKEIHALMESESLLLEKANTEFSWPSKEDSQEKIKLPPERFFQKPV
SGLSVEQVKSETISSSVKTAHFPAEGVEPALGNEKGAHRSTPPFPEGKPLEESKMVQSKV
IDDADEGKKPAPEVKIPTQRKPISSIHAKEPQSPESLEVTQKPPTQPKVAKPDLPEEKRK
RGISSFKSWMSSLFFGSSTPDNKVAEQEDLETQPSPSVEKAVTVIEPKGTIPTNFNAAEK
PADHSLSEVKLKTADEPRGTLVKSGEGQNVKEKSIILSNVEDLQQPKSISEVSREDYGKK
EISGDSEEMNINSVVTSADDENLEIQPSSLIGEKLVMEEAKTIVPLHVTDSKRVQKPAIA
PPSKWNISIFKGEPRSDQKQKSLLSFDVVDKVPQQPKSASSNFASKNITKESEKPESIIL
PVEESKGSLIDLSEDRLKKEMQNPTSLKISEEETKLRSVSPTDKKDNLENRSYTLAEKKV
LAEKQNSVAPLELRDSNEIGKTQITHGSRSTEPEESKADAMPQHFYQNEDYNERPQIIVG
SEKEKGEEKENQVYVLSEGKKQQEHQPYSVNVAESMIKESDISLGHCLGETQSFSLVKAM
SVTEKSEAMLSEAHPEIREAKAVGTQPHPLEESKVSVEKTKTFLPVALSCHDEIENHSLS
QEGNLVLEKSSRDMPDHSEEKEQFRESELSKSGSVDITKESMKQGFPSKESERTLARPFD
ETKSSATPPYLLSSVKPQTLASGASPEINAVKEQEMPQSELTPERHTVHTIQTSKDDTSD
VPKQSVLVSKHHLEAVEDTHVKEPLSSAKSNYAQFISNTSASNADKMVSNKEMPKEPEDT
YAKDEDFTVTSKPAGLAEDQKTAFSIISEGCEILNIHAPAFISSIDQEESEQMQDKLEYL
EEKASFKTIPLPDDSETVACHKTLKSRLEDEKVTPLKEHKQKETHKTKEEMSTDSETGDL
SFTQPTIPSEEDYFEKYTLIDYNISPDPEKQKAPQKLNVEEKLSKEITEETISFPGSSVE
SALEHEYDLVKLDESFYGPEKGHDILSHPETQSQNSADRNVSKDTKRDVDSKSPGMPLFE
AEEGVLSRTQIFPTTIKVVNPELLEEPPALAFLYKDLYEEAVGEKKKEEETASEGDSVNS
EASFPSRNSDTDDGTGIYFEKYILKDDILHDTSLTQKDQGQGLEEKRVGKDDSCQPIAAE
GEIWGKFGTICREKSLEEQKGVSGEGASVDHVETTGNVVMQKKAPITEDVRVATQKISYA
VPFEDTHHVLERADEAGSQGNEVGNASPEVNLNVPVQVSFPEEEFASGATHVQETPLEEP
KILVPPEPSEERLRNSPVQDEYEFAESLRNEVVPQDILSEELSSESTPEDVLSQGKESFE
HISENEFVSEAEQSTSAEQKELGSERKEENQLSSELVTEKAQKELKKSQIDTYCYTCKCP
ISATDKVFGTHKDHEVSTLDRAISAVKVQLAEFLENLQEKSLRIEAFVSEIESFFNTIEE
NCSKNEKRLEEQNEEMMKKVLAQYDEKAQSFEEVKKKKMEFLHEQMVHFLQSMDTAKDTL
ETIVREAEELDEAVFLTSFEEINERLLSAMESTASLEKMPAAFSLFEHYDDSSARSDQML
KQVAVPQPPRLEPQEPNSATSTTIAVYWSMNKEDVIDSFQVYCMEEPQDDQEVNELVEEY
RLTVKESYCIFEDLEPDRCYQVWVMAVNFTGCSLPSERAIFRTAPSTPVIRAEDCTVCWN
TATIRWRPTTPEATETYTLEYCRQHSPEGEGLRSFSGIKGLQLKVNLQPNDNYFFYVRAI
NAFGTSEQSEAALISTRGTRFLLLRETAHPALHISSSGTVISFAERRRLTEIPSVLGEEL
PSCGQHYWETTVTDCPAYRLGICSSSAVQAGALGQGETSWYMHCSEPQRYTFFYSGIVSD
VHVTERPARVGILLDYNNQRLIFINAESGQLLFIVRHRFNESVHPAFALEKPGKCTLHLG
IEPPDSVRHK
Download sequence
Identical sequences ENSNLEP00000015668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]