SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015710 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015710
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000165
Family RING finger domain, C3HC4 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015710   Gene: ENSNLEG00000012949   Transcript: ENSNLET00000016509
Sequence length 174
Comment pep:known_by_projection supercontig:Nleu1.0:GL397325.1:13136438:13174524:-1 gene:ENSNLEG00000012949 transcript:ENSNLET00000016509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDD
QSQDIVRLHQDINDYNRRFSGQPRSIMERIMDLPTLLRHAFREMFSVGGLFWMFRIRIIL
CLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR
Download sequence
Identical sequences XP_012363993.1.23891 ENSNLEP00000015710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]