SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015711 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015711
Domain Number 1 Region: 469-560
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000114
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 284-374
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000104
Family I set domains 0.065
Further Details:      
 
Domain Number 3 Region: 563-652
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000297
Family I set domains 0.018
Further Details:      
 
Domain Number 4 Region: 749-839
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000398
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 377-467
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000481
Family I set domains 0.023
Further Details:      
 
Domain Number 6 Region: 101-186
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000128
Family I set domains 0.0036
Further Details:      
 
Domain Number 7 Region: 656-745
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000896
Family I set domains 0.035
Further Details:      
 
Domain Number 8 Region: 190-269
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000895
Family I set domains 0.054
Further Details:      
 
Domain Number 9 Region: 23-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000522
Family I set domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015711   Gene: ENSNLEG00000012922   Transcript: ENSNLET00000016510
Sequence length 977
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:8145364:8183525:-1 gene:ENSNLEG00000012922 transcript:ENSNLET00000016510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWVILLVLAPVSGQFATTHRSVIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHR
YLGKEIPRETPDNTLEVQESGEYRCQAQGSGLSSPVHLDFSSASLILQAPLSVFEGDPVV
LRCRAKAEVTLNNTIYKNDDVLAFLNKRTDFHIPNASLKDNGAYRCTGYKESCCPVSSNT
VKIQVQEPFTRPMLRASSFQPISGSPVTLTCETRLSLERSDVPLRFCFFRDDQTLGSGCS
LSSKFQITAMWSKDSGFYWCQAATMPYGIISNSPRSWIQVQIPASHPVLTLSPEKALNFE
GTKVTLHCETQEDSLRTLYRFYHESVPLRHKSVRCERGASISFSLTTEHSGNYYCTADNG
LGATPSKAVSLSVTVPVSHPVLTLSSAEDLTFEGAKVTLHCEAQRGSLPILYQFHHEDAA
LGNRSANSAGGVAISFSLTAEHSGNYYCTADNGFGPQRSEVVSLSVTVPVSPPVLTLNSA
EALTFEGATVTLHCEVQRGSPRILYQFYHEDVPLGSSSTPSVGGVSFSFSLTEEHSGNYY
CTADNGFGPQRSKAVSLFVTVPVSRPILTLRVPRAQAVVGDLLELHCEALRGSPPILYWF
YHEDVTLGSSSAPSGGEASFNLSLTAEHSGNYSCEANNGLVAQHSDTISLSVIVPVSRPI
LTFRAPRAQAVVGDLLELHCEALRGSPPILYWFYHEDVTLGKISAPTGGGASFNLSLTTE
HSGIYSCEADNGLEAQRSEMVTLKVAVPVSRPVLTLRAPGAHAVVGDLLELHCEALTGSP
LILYRFYHEDVTLGNSSAPSGGASFNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGL
TANRSGPFATGVTGVLLSIAGLAAGALLLYCWLSRKAGGKPASDPARSPSDSDSREPTYH
NVPAWEELQPVYSNVNPRGENVVYSEVRIIQEKKKHAVASDPRHLRNKRSPIIYSEVKVV
STPVSRSLFLASSAPHR
Download sequence
Identical sequences G1RR47
ENSNLEP00000015711 XP_003258687.1.23891 ENSNLEP00000015711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]