SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015738 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015738
Domain Number 1 Region: 294-384
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000959
Family I set domains 0.047
Further Details:      
 
Domain Number 2 Region: 474-565
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000532
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 192-281
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000164
Family I set domains 0.022
Further Details:      
 
Domain Number 4 Region: 381-471
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000445
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 101-170
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000448
Family I set domains 0.0084
Further Details:      
 
Domain Number 6 Region: 20-85,149-171
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000886
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015738   Gene: ENSNLEG00000012970   Transcript: ENSNLET00000016539
Sequence length 742
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:8306907:8325961:-1 gene:ENSNLEG00000012970 transcript:ENSNLET00000016539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWLLLLILTPGREQSGVAPKAVLLLDPPWSTAFKGEKVDVICWGISHSPAQGDTSWYR
DEKLLKIKHNKIQITESGNYQCKTQGSSLSDAMHVEFSSDWLILQALQPVFEGDNVILRC
RGKDDKNAHQKVYYKDGKQLPNSYNLDEITVNSVSGDNSKYHCTATHREFYIFDKKETSK
LCCFFSLELFLHPVLTASSSTPIEGSPMTLTCETQLSPQRPNVQLQFSFFRDSQTLGSGW
SMSPKLQIPAMWTEDSGSYWCEAESVTHSIKKRSLRSQIRVQRVPVSDVNLEIRPTGGQL
IEGENMALICSVAQGSGTVTFSWHKEGRVRSLGRKTQHSLLAELHVLTVTESDAGRYYCA
ADNVHGPILSTWVRVTVRIPVSHPVLTFRAPRAQAAVGDLLELHCESLRGSPPILYRFYH
EDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCDADNGLGAQHSHGVSLRVTVPVSRPVLT
LRAPGAQAMVGDLLELHCESLRGSFPILYWFYHEDDTLANSSAHSGGGASFNLSLTTEHS
GNYSCEAENGLGAQHSKVVTLNVTGTSSSRTGLTAVGVTGLVLSILGLAAAAALLHYARA
RRKPGGLSATETSSHSPTECQEPSSSRPSRIDPQEPTHSKTLAPMELEPMYSNVNPGDSN
LIYSQIWSTQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEDDEE
NYENILNPGKDKVQDFPCLCNT
Download sequence
Identical sequences ENSNLEP00000015738 ENSNLEP00000015738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]