SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015762 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015762
Domain Number 1 Region: 75-118
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000652
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015762   Gene: ENSNLEG00000012991   Transcript: ENSNLET00000016563
Sequence length 122
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:32366201:32475729:1 gene:ENSNLEG00000012991 transcript:ENSNLET00000016563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMHFIMCLSKPRLSYNGRIQRRLRGARPEKTWLSGRTLQEQPWRTECSCAPIPQMQIYP
HCPVENREDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHP
AD
Download sequence
Identical sequences XP_012360952.1.23891 ENSNLEP00000015762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]