SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015764 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015764
Domain Number 1 Region: 24-67
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000174
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015764   Gene: ENSNLEG00000012991   Transcript: ENSNLET00000016565
Sequence length 71
Comment pep:known_by_projection supercontig:Nleu1.0:GL397277.1:32366201:32475729:1 gene:ENSNLEG00000012991 transcript:ENSNLET00000016565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFE
VNRSCPEHPAD
Download sequence
Identical sequences G3I4P7
ENSNLEP00000015764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]