SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015767 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015767
Domain Number 1 Region: 205-293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000017
Family I set domains 0.038
Further Details:      
 
Domain Number 2 Region: 297-386
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000141
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 21-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000157
Family I set domains 0.0062
Further Details:      
 
Domain Number 4 Region: 107-198
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000555
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015767   Gene: ENSNLEG00000012974   Transcript: ENSNLET00000016568
Sequence length 508
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:8366045:8397049:-1 gene:ENSNLEG00000012974 transcript:ENSNLET00000016568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWSLLVIFGEFNTLTDSLNLVAPSSVFEGDSIVLKCQGEQNWTIQKMAYHKDNQELSV
FKKFSDFLIQSAVLSDSGNYFCSTKGQLFFWDKSSNIVKIKVQELFQHPVLTASSFQPIE
GGPVSLKCETRRSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAMWSEDTGSYWCEAE
TVTHRIRKQSLQSQIHVQRIPVSNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWY
REATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRP
VLTLRSPGAQAVVGDLLELHCEALRGSPPILYRFYHEDVTLGNSSAPSGGGASFNLSLTA
EHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRDLMTAGVLWGLFGVLGFIGVALLLYA
LFHKISGESSATNEPRGASRPNPQELTYSSPTPDMEELQPVYVNVGSVDVDVVYSRVWSI
QQPEGSAHIRTLLENKDSQVIYSAVKKS
Download sequence
Identical sequences ENSNLEP00000015767 ENSNLEP00000015767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]