SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015781 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015781
Domain Number 1 Region: 113-201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000845
Family I set domains 0.025
Further Details:      
 
Domain Number 2 Region: 205-293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000206
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 20-99
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000135
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015781   Gene: ENSNLEG00000012998   Transcript: ENSNLET00000016583
Sequence length 429
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:8415361:8440132:-1 gene:ENSNLEG00000012998 transcript:ENSNLET00000016583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRLLLLICAPLCEPAGAVVIASPSHPTEGSPVTLMCKMPFLWSSDAQFQFCFFRDARA
LGPGWSSSSKLQIAAMWKEDSGSYWCEAQTMASKVLRSSRSQINVHRVPVTDVSLETQPP
GGQVMEGDRLVLICSVAMGTGDITFLWYKGTVGLNLQTKIQRSLTAEYEIPTARESDAEQ
YYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILY
WFYHEDITLGSSSAPSGGGASFNLSLTAEHSGNYSCEANNGLGAQRSEAVTLSFTVPTGA
RSNHLTSGVIEGLLGTLGPATVALLFCYGLKRKIGRRSARDPLRSLPSPVPQEFTYLNSA
TPRQLQPIYENVNVVSGDEVYSLAYYNQPDQESVAAETLGTHMEDKVSLDNYSRPRKANI
TDGDYEDAM
Download sequence
Identical sequences ENSNLEP00000015781 ENSNLEP00000015781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]