SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015804 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015804
Domain Number 1 Region: 55-94,153-342,385-452
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.17e-80
Family TRM1-like 0.00036
Further Details:      
 
Domain Number 2 Region: 550-578
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000183
Family CCCH zinc finger 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015804   Gene: ENSNLEG00000013019   Transcript: ENSNLET00000016609
Sequence length 610
Comment pep:known_by_projection supercontig:Nleu1.0:GL397381.1:4356021:4368171:-1 gene:ENSNLEG00000013019 transcript:ENSNLET00000016609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGSSMWLSLTFRRARVLCRVQFFEWQSPGLPNPAAMENGTGPYGEERPREVQETTVTEG
AAKIAFPSANEVFYNPVQEFNRDLTCAVITEFARIQLGAKGIQIKVPGEKDTQKVVVDLS
EQEEEKVELKESENRASGDQPRIAAVGEICEEGLHVLEGLAASGLRSIRFALEVPGLRSV
VANDASARAVDLIRQNVQLNDVAHLVQPSQADARMLMYQHQRVSERFDVIDLDPYGSPAP
FLDAAVQAVSEGGLLCVTCTDVAVLAGNSGETCYSKYGAMALKSRACHEMALRIVLHSLD
LRANCYQRFVVPLLSISADFYVRVFVRVFTGQAKVKGLSQVSLGGRECGGGGCGEPRLRI
ALQPERQSETPSQKKKKRKKRNELCSHKPLPKVLTYTGQLRLWSQGVRHLPSLLFPRSAL
LHADFRVSLSHACRNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAYRILSVEPRL
QANFTIREDANPSSRQRGLKRFQANPEANWGPRPRARPGGKEADAAMEERRRLLQNKRKE
PPEDAAQRAARLKTFPCKRFKEGTCQRGDQCCYSHSPPTPRVSADAAPDCPETSNQSPPG
PGAAAGPGID
Download sequence
Identical sequences ENSNLEP00000015804 ENSNLEP00000015804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]