SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015810 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015810
Domain Number 1 Region: 307-395
Classification Level Classification E-value
Superfamily Immunoglobulin 6.86e-18
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 119-223
Classification Level Classification E-value
Superfamily Immunoglobulin 2.31e-17
Family C1 set domains (antibody constant domain-like) 0.024
Further Details:      
 
Domain Number 3 Region: 22-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000353
Family V set domains (antibody variable domain-like) 0.052
Further Details:      
 
Domain Number 4 Region: 219-304
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000661
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 392-487
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000381
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015810   Gene: ENSNLEG00000013017   Transcript: ENSNLET00000016615
Sequence length 757
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:8615594:8719002:1 gene:ENSNLEG00000013017 transcript:ENSNLET00000016615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLLVWILTLSDTFSQGTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGIVQWTKDGLAL
GMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPP
EDTRIDGGPVILLQAGTPHNLTCRAFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRET
TVSQLLINPTDLDIGRVFTCRSMNEAIPSGKETSIELDVHHPPTVTLSIEPQTVQEGERV
VFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVST
LVNVHFAPRIVVDPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKS
VTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDGGKVECFIGSTPP
PDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGP
GTAIIQLEEREVLPVGIIAGATIGASILLIFFFIALVFFLYRRRKGSRKDVTLRKLDIKV
ETVNREPLTMHSDREDDTTSVSTATRVMKAIYSSFKDDVDLKQDLRCDTIDTREEYEMKD
PTNGYYNVRAHEDRPSSRAVLYADYRAPGPARFDGRPSSRLSHSSGYAQLNTYSRAPASD
YGPEPTPPGPAAPAGTDTTSQLSYENYEKFNSHPFPGAAGYPTYRLGYPQAPTSGLERTP
YEAYDPIGKYATATRFSYTSQHSDYGQRFQQRMQTHV
Download sequence
Identical sequences ENSNLEP00000015810 ENSNLEP00000015810 XP_003258695.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]