SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015821 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015821
Domain Number 1 Region: 23-200
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.54e-55
Family MHC antigen-recognition domain 0.0000000204
Further Details:      
 
Domain Number 2 Region: 208-294
Classification Level Classification E-value
Superfamily Immunoglobulin 2.9e-21
Family C1 set domains (antibody constant domain-like) 0.00000732
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015821   Gene: ENSNLEG00000013040   Transcript: ENSNLET00000016627
Sequence length 327
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:8884043:8888162:1 gene:ENSNLEG00000013040 transcript:ENSNLET00000016627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVLLLPLLAVLPGDGNANGLEEPVSFHVIHIASFYNHSWKRCLSSGWLSDLQTHAWDRN
SSTIIFLWPWSRGNFSNGEWKELEMLFRIRTIQLFEGIPRHAHELQFEYPFEIQVTGGCK
LHSGKVSGSFLRLAYQGSDFVRFQNNSWLPYPAAGNRAKHFCKVANQNQHENDITHSLLS
DTCPRFILGLLDAGKAYLQRQVKPEAWLSGGPSPGPGHLQLVCHVSGFYPKPVWVMWTRG
EQEQQGTQRGDILPSADGTWYLRATLEVAAGEAAGLSCRVKHSSLEGQDIVLYWEHHSSV
GLIILAVIVPLLLLTGLALWFRKRCFC
Download sequence
Identical sequences G1RRF7
XP_003258697.1.23891 ENSNLEP00000015821 ENSNLEP00000015821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]