SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015832 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015832
Domain Number 1 Region: 1636-1822
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.31e-35
Family Laminin G-like module 0.00051
Further Details:      
 
Domain Number 2 Region: 1458-1634
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-32
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 1049-1230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.67e-22
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 1229-1404
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.02e-22
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 5 Region: 833-1030
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-18
Family Laminin G-like module 0.0067
Further Details:      
 
Domain Number 6 Region: 187-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000753
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 7 Region: 141-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family Laminin-type module 0.04
Further Details:      
 
Domain Number 8 Region: 82-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015832
Domain Number - Region: 738-805
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0706
Family FAT domain of focal adhesion kinase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015832   Gene: ENSNLEG00000013000   Transcript: ENSNLET00000016638
Sequence length 1823
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:3766972:3917428:-1 gene:ENSNLEG00000013000 transcript:ENSNLET00000016638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRL
PPAAEKCNAGFFRTLSGECVPCDCNGNSNECLDGSGFCMHCQRNTTGEHCEKCLDGYIGD
SIRGAPQFCQPCPCPLPHLANFAESCYRKNGAVQCICNENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGFEPPTGMDCPTISCDKCVWDLTDDLRLAALSIEEGKSGVLS
VSSGAAAHRHVNEINATIYLLKTKLSERENQYTLRKIQINNAENTMKSLLSDIEELVEKE
NQASRKGQLVQKESMDTINHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL
VLAQNMLEEIRSRQPFFTQRELVDEEADEAYELLSQAESWQRLHNETRTLFPVVLEQLDD
YNAKLSDLQEALDQALNHVRDAEDMNRATAARQRDHEKQQERVREQMEVVNMSLSTSADS
LTTPRLTLSELDDIIKNASGIYAEIDGAKNELQVKLSNLSNLSHDLVQEAIDHAQDLQQE
ANELSRKLHSSDMNGLVQKALDASNVYENIVNYVGEANETAEFALNTTDRIYDAVSGIDT
QIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGGALARKSALKTRLSDAVKQLQ
AAERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFDSSAYNTAVDS
ARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG
QSAVEVHSRTSMDDLKAFTSLSLYMKPPVKRPELTETADQFILYLGSKNAKKEYMGLAIK
NDNLVYVYNLGTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKF
IKKGEFSGDDSLLDLDPEDTVFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYN
FKHIYNMDPSTSVPCARDKLAFTQSRAASYFFDGSGYAVVRDIARRGKFGQVTRFDIEVR
TPADNSLILLMVNGSMFFRLEMRNGYLHVFYDFGFSSGPVHLEDTLKKAQINDAKYHEIS
IIYHNDKKMILVVDRRHVKSMENEKMKIPFTDIYIGGAPPEILQSRTLRAHLPLDINFRG
CMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG
FNFRTLQPNGLLFYYASGSDVFSISLDNGTVVMNVKGIKVQSVDEQYNDGLSHFVITSVS
PTRYELIVDKSRVGSKNPTKGKIEQTQAGEKKFYFGGSPISAQYANFTGCISNAYFTRVD
RDVEVEDFQRYTEKVHTSLYECPIESSPLFLLHKKGKNLSKPKASQNKKGGKSKDAPSWD
PVALKFPEWNTPRNSHCHLSNSPRAIEHAYQYGGTANSRQEFEHLKGDFGAKSQFSIRLR
TRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKLKIRSQEKYNDGLWHDVIFIR
ERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINSIYSFSGCLSN
LQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS
SSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDS
NVVQLDVDSEVNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDG
HPVSFSKAALVSGAVSINSCPAA
Download sequence
Identical sequences G1RRG8
XP_004087678.1.23891 XP_012361473.1.23891 ENSNLEP00000015832 ENSNLEP00000015832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]