SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015841 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015841
Domain Number 1 Region: 24-201
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.72e-57
Family MHC antigen-recognition domain 0.00000000789
Further Details:      
 
Domain Number 2 Region: 208-295
Classification Level Classification E-value
Superfamily Immunoglobulin 8.49e-22
Family C1 set domains (antibody constant domain-like) 0.00000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015841   Gene: ENSNLEG00000013051   Transcript: ENSNLET00000016648
Sequence length 333
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:8937014:8940609:-1 gene:ENSNLEG00000013051 transcript:ENSNLET00000016648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLPFQLLVVLFPGGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDS
DSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGC
ELHSGGAIVSFLRGALGGLDFLSIKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILL
YETCPRYLLGVLNAGKADLQRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMR
DEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCRVKHSSLEGQDIILYWRNPTS
IGSIVLAIIVPSLLLLLCLALWYMRRRSYQNIP
Download sequence
Identical sequences G1RRH7
ENSNLEP00000015841 ENSNLEP00000015841 XP_003258699.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]