SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015851 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015851
Domain Number 1 Region: 30-204
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.86e-51
Family MHC antigen-recognition domain 0.00000324
Further Details:      
 
Domain Number 2 Region: 206-292
Classification Level Classification E-value
Superfamily Immunoglobulin 6.18e-19
Family C1 set domains (antibody constant domain-like) 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015851   Gene: ENSNLEG00000013061   Transcript: ENSNLET00000016659
Sequence length 339
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:8962054:8965249:1 gene:ENSNLEG00000013061 transcript:ENSNLET00000016659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKSRMKRYRRRRGSRAPQALQSYRLAAEEPLSFRMLQTSSFANHSWAHSEGSGWLGDLQ
THGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIWIVQASAGQFQLEYPFEI
QILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNVCKVLNRYLDIKEILQ
SLLGHTCPRFLAGLMEAGESELKRKVKPQAWLSRGPSPGAGRLQLVCHVSGFYPKPMWVM
WMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEAAGLACRVKHSSLEGHDLIIHWGE
KQPRLCWEIMKVALGLLSVGLRKWVGMLGTRRVKLGQSK
Download sequence
Identical sequences ENSNLEP00000015851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]