SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015898 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015898
Domain Number 1 Region: 449-591
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-21
Family MAM domain 0.00097
Further Details:      
 
Domain Number 2 Region: 186-285
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000377
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 116-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015898
Domain Number - Region: 53-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015898   Gene: ENSNLEG00000013090   Transcript: ENSNLET00000016712
Sequence length 595
Comment pep:known_by_projection supercontig:Nleu1.0:GL397271.1:25911950:26004282:-1 gene:ENSNLEG00000013090 transcript:ENSNLET00000016712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLLALVLVSSLYLQAAAEFDGRWPRQIMSSIGLCRYGGRIDCCWGWARQSWGQCQPVC
QPRCKHGECIGPNKCKCHPGYAGKTCNQDKHIPAPLDQGSEQPLFQPLDHQATSLPSRDL
NECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGSCSSALTCSMANCQYGCDVVKGQIR
CQCPSPGLQLAPDGRTCVDVDECATGRASCPRFRQCANTFGSYICKCHKGFDLMYIGGKY
QCHDVDECSLGQYQCSSFARCYNIHGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVP
KGNGTILKGDGGHNNWIPDVRSTWWPPKTPYIPPIITNRPTSKPTTRPTPKPIPIPTPPP
PPPLPTELRTPLPPTTPERPTTRLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQ
PSNDLFEIFEIERGVSADDEAKDDPGVLVHSCNFDHGLCGWIREKDNDLHWEPIRDPAGG
QYLTVSAAKAPGEKAARLVLPLGRLMHSGDLCLSFRHKVTGLHSGTLQVFVRKHGAQGAA
LWGRNGGHGWRQTQITLRGADIKSVIFKGEKRRGHTGEIGLDDVSLRKGHCSEER
Download sequence
Identical sequences G1RRN3
ENSNLEP00000015898 ENSNLEP00000015898 XP_003257502.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]