SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015941 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015941
Domain Number 1 Region: 210-311
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 4.71e-43
Family HIN-200/IF120x domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 312-398
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 4.18e-34
Family HIN-200/IF120x domain 0.0000129
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015941
Domain Number - Region: 6-85
Classification Level Classification E-value
Superfamily DEATH domain 0.00589
Family Pyrin domain, PYD 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015941   Gene: ENSNLEG00000013125   Transcript: ENSNLET00000016756
Sequence length 492
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:9443859:9483305:1 gene:ENSNLEG00000013125 transcript:ENSNLET00000016756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADLMEEKFPGDA
GLGKLIEFFKEIPTLGDLAETLKREKLKVVNKIESIPVKGITPSKKTKQKEVDPATPAST
PSNRLTAKGAEETLGPQKRKKPSEEETGAKRSKMSKEQTRPSCSAGAGMSTAMGRSPPPQ
TSSSAPPNTSSTESVKPSANRQATASKNIFREDPVIVMVLNATKIFKYESLENEQRRMFH
ATVATQTQFFHVKVLNINLKGKFIKKRIIIISNYSKHNSLLEVNEASSVSEAGPDQTFEV
PKDIIRRAKKTPKINILHKQTSGYIVYGLFMLHTKIVNRKTTIYEIQDKTGSMAVVGKGE
CHNIPCEKGDKLRLFCFRLRKRENMSKLMSEMHSFIQIQKNTNQRSHDSRSMALPQQQSQ
HPKPSEAGTTLPESRLKTPQMPPTTPSSSSFTKKDEAHAGAQSSPTNFRIISPTVAPPVS
SDTSTNRHPEVP
Download sequence
Identical sequences ENSNLEP00000015941 ENSNLEP00000015941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]