SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015957 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015957
Domain Number 1 Region: 203-304
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 4.45e-42
Family HIN-200/IF120x domain 0.00000232
Further Details:      
 
Domain Number 2 Region: 521-619
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 1.65e-39
Family HIN-200/IF120x domain 0.00018
Further Details:      
 
Domain Number 3 Region: 620-708
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 7.59e-34
Family HIN-200/IF120x domain 0.00021
Further Details:      
 
Domain Number 4 Region: 306-391
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 8.37e-34
Family HIN-200/IF120x domain 0.00000317
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015957
Domain Number - Region: 11-89
Classification Level Classification E-value
Superfamily DEATH domain 0.000471
Family Pyrin domain, PYD 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015957   Gene: ENSNLEG00000013156   Transcript: ENSNLET00000016772
Sequence length 732
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:9522733:9558667:1 gene:ENSNLEG00000013156 transcript:ENSNLET00000016772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVKMEKKYKNIVLLKGLEVINDYHFRTVKSLLSSDLKLNPKMREEYDKIQIADLMEEKF
RGDAGLGKLIQIFKNIPALENLAETLKKEKLKAKGSAASRKTKKAVDAASPAPSTSSTVK
TEGAEATPGAQKRKKPTKEKAGPKRSKVSKEQTQPPCPAGAGMSTAMGHSPSPETSSSAP
PNTSSTECYHTQNPTTVARRSVLQKGPLIVKVLSTTKPFEYETPEMEKKIMFHATVATQT
QFFHVKVLNTSLKEKFNGKKMIMISDYLEYDSLLEVNEKSTVSEADPDQTFEVPNRIISR
AKETLRIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCE
EGDKLQLFCFRLRKKNQMSKLISEMHSFIQIKKKTNPRNNDPKSMKQPQEQSQLPNPSDA
GTTSSESHPWTPQMPPTTPSSSFFTKKSEDTITKMNDVMRMQILKEESHFPGSFRTSIGP
AESYPHTPQMPPSTPSSSFLTTLKPRLKTEPEEVSIEDSAQSDFKKVMVLNVTESFVYKP
EEQKKMFHATVATENEVFRVKVFNTDLKEKFTPKKIIAISNYVCRDGFLEVYPSTLVADV
NADRKMEIPQRLIRSANTTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGK
MEVVVYGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVTHSHIKVIKTRKNKKDILNP
DSSMETSADFFF
Download sequence
Identical sequences ENSNLEP00000015957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]