SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015988 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015988
Domain Number 1 Region: 235-335
Classification Level Classification E-value
Superfamily Immunoglobulin 2.03e-26
Family C1 set domains (antibody constant domain-like) 0.00000607
Further Details:      
 
Domain Number 2 Region: 16-107
Classification Level Classification E-value
Superfamily Immunoglobulin 5.26e-22
Family C1 set domains (antibody constant domain-like) 0.00066
Further Details:      
 
Domain Number 3 Region: 126-229
Classification Level Classification E-value
Superfamily Immunoglobulin 1.93e-17
Family C1 set domains (antibody constant domain-like) 0.00000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015988   Gene: ENSNLEG00000013184   Transcript: ENSNLET00000016806
Sequence length 412
Comment pep:novel contig::ADFV01143507.1:262:6986:1 gene:ENSNLEG00000013184 transcript:ENSNLET00000016806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPRPHSAFCVPASPTSPNVFPLSLDSTQPDGNVVVACLVQGFFPQEPLSVTWSESGQNVT
ATNFPPSQDASGGLYTTSSQLTLPATQCLVGKSVTCHVKHYTNPSQDVTVPCRAPGGGHL
STPAPPPHPCCQPRLSLHQPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKNAVQ
GPSERDLCGCYSVSSILPGCAEPWKHGKTFTCTAAQPESETQLTATLSKSGNTFRPEVHL
LPPPSEELALNELVTLTCLARGFSPEDVLVRWLHGSQELPREKYLTWASQQEPSQGTTTF
AVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGSCCVADWQMLPPYVVLDL
PQETLEEETPGANLWPTTITFLALFLLSLFYSTALTVTSVRGPSGKREGPQY
Download sequence
Identical sequences ENSNLEP00000015988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]