SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015991 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015991
Domain Number 1 Region: 121-228
Classification Level Classification E-value
Superfamily Fibronectin type III 1.98e-21
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 2 Region: 218-314
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000108
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015991   Gene: ENSNLEG00000013166   Transcript: ENSNLET00000016809
Sequence length 399
Comment pep:known_by_projection supercontig:Nleu1.0:GL397633.1:4671:27972:1 gene:ENSNLEG00000013166 transcript:ENSNLET00000016809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLVTSLLLCELPHPAFLLIPEKLDPRTVVPASSLNVRFDSRTMNLSWDCQENTTFSRC
FLIDKKNRVVEPRLSNNECSCTFCEICLHEGVTFEVHVNTSQREFQQKLLYPNSERESTA
AHNFSCFIYNVDFMNCTWARGSTALHDVQYFLYIQNSNRKREIRCPYYIQDSGTHVGCHL
DNLSGLTSRNYFLVNGTSEIGIQFFDSLLDTKKIERFNPPGNVTVRCNTTHCLVRWKQPR
TYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADV
RILNWSSWSEATEFGSDGRNLSSVYIYMLLIMGTLVCGLILGFLFKRFLRIQQLFPPVPQ
IKDKLNDNHEVEDEVIWEEFTPEEGKDYREEVLAVKEIT
Download sequence
Identical sequences G1RRX1
ENSNLEP00000015991 ENSNLEP00000015991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]