SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015993 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015993
Domain Number 1 Region: 82-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.63e-41
Family Reprolysin-like 0.0049
Further Details:      
 
Domain Number 2 Region: 1064-1128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 736-803
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000314
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number 4 Region: 1016-1070
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0085
Further Details:      
 
Domain Number 5 Region: 946-1010
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 1187-1279
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000392
Family Spermadhesin, CUB domain 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000015993
Domain Number - Region: 682-741
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00144
Family TSP-1 type 1 repeat 0.0097
Further Details:      
 
Domain Number - Region: 384-437
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0116
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number - Region: 900-949
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0419
Family TSP-1 type 1 repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015993   Gene: ENSNLEG00000013159   Transcript: ENSNLET00000016811
Sequence length 1425
Comment pep:known_by_projection supercontig:Nleu1.0:GL397403.1:3123054:3164118:1 gene:ENSNLEG00000013159 transcript:ENSNLET00000016811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQHHPRARARCPPLCVAGILACGFLLGCWGPSHFQQSCLQALESQAVSSYSSPGAPVKG
RPPSPGFQRQRRRQRRAAGSILHLELLVAVGLMSFQAHQEDTERYVLTNLNIGAELLRDP
SLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSRTINPEDDTDPGHADLVLYI
TRFDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGLEHDGAP
RSGCGPSGHVMASDGAAPRAGLAWSPCSRRQLLSLLSAGRARCVWDPPRPQPGSAGRPPE
AQPGLYYSANEQCRVAFGPKAVACTFAREHPDMCQALSCHTDPLDQSSCSRLLVPLLDGT
ECGVEKVRAKTRARGCLQPGCPIPRSGGRTSMGQRSPCGSLCVGGSLWVSSLCVPAFGGR
ACVGADLQAEMCNTQACEKTQLEFMSEQCARTDGQPLHSSPGGASFYRWGAAVPHSQGDA
LCRHMCRAVGESFIMKRGDSFLDGTRCMPSGPREDGTLSLCVSGSCRTFGCDGRMDSQQV
QDACQVCGGDNSTCSPQKGSFTAGRAREYVTFLTVTPNLTSVYIANHRPLFTHLAVRIGG
RYVVAGKTSISPNTTYPSLLEDGRVEYRVALTEDRLPRLEEIRIWGPLQGDAEIQVYRRY
GEEYGNLTCPDITFTYFQPKPLQAWVWAAVRGPCSVSCGAGLRWVNYSCLDQARKELVET
VRCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSVSCGGGLRERPVRCVEARGSLLKTLP
PARCRAGAQQPAVAVETCNPQPCPARWKVSEPSPCTSAGGAGLALENETCVPGDGLEAPA
TEGPGSVDEKLPAPEPCVGMSCPLGWGHLDATSAGEKAPSPWGSIRTKAQAAHVWTPVAG
PCSVSCGRGLMELRFLCMDSALRVPVQEELCGLASKPGSRREVCQAVPCPARWRYKLAAC
SVSCGGGVVRRILYCARAHGEDDGEEILLDTQCQGLPRPEPQEACSLEPCPPRWKVMSLG
PCSASCGLGTARRSVACVQLDQGRDVEVDEAVCAALVQPQASVPCLIANCTYRWHVSTWM
ECSVSCGDGIQRRHDTCLGPQAQAPVPADFCQHLPKPVTVRGCWAGPCVGQETPSLVPHE
EAAAPGQTTATPAGASLEWSQARALLFSPAPQPRRLLPGPQENSAQSSACGRQHLEPTGT
IDMRGPGQADCAVAIGRPLGEVVTLRILESSLNCSAGDMLLLWGRLTWRKMCRKLLDMTF
SSKTNTLVVRQRCGRPGGGVLLRYRSQLAPETFYRVLHPSSLGPCSKMDRLSLSPCTGAA
GPCQKATNLLSPNSSGHHGWSLSLVPGSMVANASYVSIRDTHSLRTTAFHGQQVLYWESE
SSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEVQDPQSWKGKEGT
Download sequence
Identical sequences ENSNLEP00000015993 ENSNLEP00000015993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]